Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BLI_RS16565 | Genome accession | NC_006322 |
| Coordinates | 3210652..3210792 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis DSM 13 = ATCC 14580 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3205652..3215792
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BLI_RS16535 (BLi03354) | - | 3205766..3206953 (-) | 1188 | Protein_3273 | sensor histidine kinase | - |
| BLI_RS16550 (BLi03357) | comP | 3208224..3209375 (-) | 1152 | WP_227616443.1 | PDZ domain-containing protein | Regulator |
| BLI_RS16555 (BLi03358) | comX | 3209415..3209579 (-) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| BLI_RS16560 (BLi03359) | comQ | 3209594..3210463 (-) | 870 | WP_011198252.1 | polyprenyl synthetase family protein | Regulator |
| BLI_RS16565 (BLi03360) | degQ | 3210652..3210792 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| BLI_RS16575 (BLi03361) | - | 3211278..3211625 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| BLI_RS16580 (BLi03362) | - | 3211668..3212888 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| BLI_RS16585 (BLi03363) | - | 3213067..3214536 (-) | 1470 | WP_003184866.1 | nicotinate phosphoribosyltransferase | - |
| BLI_RS16590 (BLi03364) | - | 3214554..3215105 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| BLI_RS16595 (BLi03365) | - | 3215290..3215691 (-) | 402 | WP_011201726.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=24095 BLI_RS16565 WP_003184860.1 3210652..3210792(-) (degQ) [Bacillus licheniformis DSM 13 = ATCC 14580]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=24095 BLI_RS16565 WP_003184860.1 3210652..3210792(-) (degQ) [Bacillus licheniformis DSM 13 = ATCC 14580]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |