Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   CF389_RS12445 Genome accession   NZ_CP022556
Coordinates   2542080..2542199 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain NJAU-Z9     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 2537080..2547199
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CF389_RS12415 - 2537319..2538077 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  CF389_RS12420 - 2538071..2539018 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  CF389_RS12425 ceuB 2539008..2539961 (-) 954 WP_003156332.1 ABC transporter permease Machinery gene
  CF389_RS12435 - 2540376..2541740 (+) 1365 WP_003156333.1 aspartate kinase -
  CF389_RS12440 - 2541820..2541930 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  CF389_RS12445 phrC 2542080..2542199 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  CF389_RS12450 rapC 2542183..2543331 (-) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  CF389_RS12455 - 2543484..2544917 (-) 1434 WP_162130794.1 sensor histidine kinase -
  CF389_RS12460 - 2544904..2545587 (-) 684 WP_003156341.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=240736 CF389_RS12445 WP_003156334.1 2542080..2542199(-) (phrC) [Bacillus velezensis strain NJAU-Z9]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=240736 CF389_RS12445 WP_003156334.1 2542080..2542199(-) (phrC) [Bacillus velezensis strain NJAU-Z9]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment