Detailed information NTG0024068

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BLI_RS13110
• Genome accession: NC_006322
• Coordinates: 2555168..2555605 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis DSM 13 = ATCC 14580
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2550168..2560605

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BLI_RS13060 (BLi02635)	sinI	2550337..2550513 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
BLI_RS13065 (BLi02636)	sinR	2550547..2550882 (+)	336	WP_006637528.1	transcriptional regulator SinR	Regulator
BLI_RS13070 (BLi02637)	tasA	2550987..2551781 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
BLI_RS13075 (BLi02638)	sipW	2551855..2552439 (-)	585	WP_003183449.1	signal peptidase I SipW	-
BLI_RS13080 (BLi02639)	tapA	2552436..2553164 (-)	729	WP_011198112.1	amyloid fiber anchoring/assembly protein TapA	-
BLI_RS13085 (BLi02640)	-	2553441..2553761 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
BLI_RS13090 (BLi02641)	-	2553791..2553973 (-)	183	WP_003183456.1	YqzE family protein	-
BLI_RS13095 (BLi02642)	comGG	2554062..2554427 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
BLI_RS13100 (BLi02643)	comGF	2554440..2554928 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
BLI_RS13105 (BLi02644)	comGE	2554837..2555184 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
BLI_RS13110 (BLi02645)	comGD	2555168..2555605 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
BLI_RS13115 (BLi02646)	comGC	2555611..2555904 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
BLI_RS13120 (BLi02647)	comGB	2555918..2556952 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
BLI_RS13125 (BLi02648)	comGA	2556942..2558006 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
BLI_RS13130 (BLi02649)	-	2558163..2559002 (-)	840	WP_003183480.1	STAS domain-containing protein	-
BLI_RS13140 (BLi02651)	-	2559244..2559621 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
BLI_RS13145 (BLi02652)	-	2559830..2560075 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=24068 BLI_RS13110 WP_009327905.1 2555168..2555605(-) (comGD) [Bacillus licheniformis DSM 13 = ATCC 14580]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=24068 BLI_RS13110 WP_009327905.1 2555168..2555605(-) (comGD) [Bacillus licheniformis DSM 13 = ATCC 14580]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393