Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C7M27_RS05745 Genome accession   NZ_CP028213
Coordinates   1115341..1115514 (-) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102749     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1110341..1120514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M27_RS05700 (C7M27_01123) comGE 1110692..1111039 (+) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  C7M27_RS05705 (C7M27_01124) comGF 1111065..1111448 (+) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M27_RS05710 (C7M27_01125) comGG 1111449..1111823 (+) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  C7M27_RS05715 (C7M27_01126) spoIITA 1111895..1112074 (+) 180 WP_014480252.1 YqzE family protein -
  C7M27_RS05720 (C7M27_01127) yqzG 1112116..1112442 (-) 327 WP_021480018.1 YqzG/YhdC family protein -
  C7M27_RS05725 (C7M27_01128) tapA 1112713..1113474 (+) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  C7M27_RS05730 (C7M27_01129) sipW 1113458..1114030 (+) 573 WP_003246088.1 signal peptidase I SipW -
  C7M27_RS05735 (C7M27_01130) tasA 1114095..1114880 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C7M27_RS05740 (C7M27_01131) sinR 1114972..1115307 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M27_RS05745 (C7M27_01132) sinI 1115341..1115514 (-) 174 WP_014477323.1 anti-repressor SinI Regulator
  C7M27_RS05750 (C7M27_01133) yqhG 1115698..1116492 (-) 795 WP_032726154.1 YqhG family protein -
  C7M27_RS05755 (C7M27_01134) hepAA 1116513..1118186 (-) 1674 WP_038829735.1 SNF2-related protein -
  C7M27_RS05760 (C7M27_01135) gcvT 1118628..1119716 (+) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=240035 C7M27_RS05745 WP_014477323.1 1115341..1115514(-) (sinI) [Bacillus subtilis strain SRCM102749]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=240035 C7M27_RS05745 WP_014477323.1 1115341..1115514(-) (sinI) [Bacillus subtilis strain SRCM102749]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982