Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C7M26_RS01375 Genome accession   NZ_CP028212
Coordinates   220424..220597 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SRCM102748     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 215424..225597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M26_RS01330 (C7M26_00258) comGE 215774..216121 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  C7M26_RS01335 comGF 216147..216530 (+) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  C7M26_RS01340 (C7M26_00259) comGG 216531..216905 (+) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  C7M26_RS01345 (C7M26_00260) spoIITA 216977..217156 (+) 180 WP_029726723.1 YqzE family protein -
  C7M26_RS01350 (C7M26_00261) yqzG 217198..217524 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M26_RS01355 (C7M26_00262) tapA 217796..218557 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  C7M26_RS01360 (C7M26_00263) sipW 218541..219113 (+) 573 WP_072692741.1 signal peptidase I SipW -
  C7M26_RS01365 (C7M26_00264) tasA 219177..219962 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M26_RS01370 (C7M26_00265) sinR 220055..220390 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M26_RS01375 (C7M26_00266) sinI 220424..220597 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M26_RS01380 (C7M26_00267) yqhG 220780..221574 (-) 795 WP_015714249.1 YqhG family protein -
  C7M26_RS01385 (C7M26_00268) hepAA 221595..223268 (-) 1674 WP_029726726.1 SNF2-related protein -
  C7M26_RS01390 (C7M26_00269) gcvT 223710..224798 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=239850 C7M26_RS01375 WP_003230187.1 220424..220597(-) (sinI) [Bacillus subtilis strain SRCM102748]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=239850 C7M26_RS01375 WP_003230187.1 220424..220597(-) (sinI) [Bacillus subtilis strain SRCM102748]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment