Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   CGZ63_RS02035 Genome accession   NZ_CP022445
Coordinates   371334..371612 (+) Length   92 a.a.
NCBI ID   WP_089607186.1    Uniprot ID   -
Organism   Bacillus cereus C1L     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 362530..402653 371334..371612 within 0


Gene organization within MGE regions


Location: 362530..402653
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CGZ63_RS01975 - 362530..363654 (-) 1125 WP_089607176.1 tyrosine-type recombinase/integrase -
  CGZ63_RS01980 - 364175..364486 (-) 312 WP_089607177.1 hypothetical protein -
  CGZ63_RS01985 - 364787..365650 (-) 864 WP_089607178.1 hypothetical protein -
  CGZ63_RS01990 - 366212..367351 (+) 1140 WP_089607179.1 AimR family lysis-lysogeny pheromone receptor -
  CGZ63_RS32250 - 367354..367497 (+) 144 WP_000710221.1 hypothetical protein -
  CGZ63_RS33050 - 367723..367845 (+) 123 WP_000237930.1 hypothetical protein -
  CGZ63_RS01995 - 367865..368218 (-) 354 WP_000172107.1 helix-turn-helix transcriptional regulator -
  CGZ63_RS02000 - 368431..368682 (+) 252 WP_232732735.1 helix-turn-helix transcriptional regulator -
  CGZ63_RS02005 - 368679..369029 (+) 351 WP_089607181.1 helix-turn-helix domain-containing protein -
  CGZ63_RS02010 - 369026..369193 (+) 168 WP_000969632.1 hypothetical protein -
  CGZ63_RS32255 - 369223..369399 (+) 177 WP_089607182.1 hypothetical protein -
  CGZ63_RS02020 - 369406..370293 (+) 888 WP_089607183.1 DnaD domain protein -
  CGZ63_RS02025 - 370232..371107 (+) 876 WP_089607184.1 ATP-binding protein -
  CGZ63_RS02030 - 371123..371317 (+) 195 WP_089607185.1 hypothetical protein -
  CGZ63_RS02035 abrB 371334..371612 (+) 279 WP_089607186.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  CGZ63_RS02040 - 371605..371964 (+) 360 WP_089607187.1 cell division protein SepF -
  CGZ63_RS02045 - 371983..372150 (+) 168 WP_088065306.1 DUF3954 domain-containing protein -
  CGZ63_RS02050 - 372176..372427 (+) 252 WP_000109542.1 hypothetical protein -
  CGZ63_RS02055 - 372447..372956 (+) 510 WP_088065305.1 dUTP diphosphatase -
  CGZ63_RS32690 - 372997..373479 (+) 483 WP_232732722.1 hypothetical protein -
  CGZ63_RS02065 - 373515..373706 (+) 192 WP_016111352.1 hypothetical protein -
  CGZ63_RS02070 - 373726..374271 (+) 546 WP_089607188.1 hypothetical protein -
  CGZ63_RS32260 - 374296..374439 (+) 144 WP_198512960.1 hypothetical protein -
  CGZ63_RS02075 - 374436..374819 (+) 384 WP_232732723.1 hypothetical protein -
  CGZ63_RS02080 - 374860..375069 (+) 210 WP_089607189.1 hypothetical protein -
  CGZ63_RS02085 - 375314..375523 (+) 210 WP_089607190.1 hypothetical protein -
  CGZ63_RS02090 - 375555..375983 (+) 429 WP_089607191.1 hypothetical protein -
  CGZ63_RS32265 - 376011..376178 (+) 168 WP_000539655.1 hypothetical protein -
  CGZ63_RS02095 - 376322..376720 (+) 399 WP_089607192.1 hypothetical protein -
  CGZ63_RS02100 - 376757..376969 (+) 213 WP_089607193.1 hypothetical protein -
  CGZ63_RS02105 - 377002..377322 (+) 321 WP_089607194.1 hypothetical protein -
  CGZ63_RS02110 - 377366..377644 (+) 279 WP_089607195.1 hypothetical protein -
  CGZ63_RS02115 - 377677..377904 (+) 228 WP_078187670.1 hypothetical protein -
  CGZ63_RS32270 - 378018..378182 (-) 165 WP_000140899.1 hypothetical protein -
  CGZ63_RS02125 - 378285..378566 (+) 282 WP_089607196.1 PadR family transcriptional regulator -
  CGZ63_RS32275 - 378677..378847 (+) 171 WP_089607197.1 hypothetical protein -
  CGZ63_RS02135 - 378875..379357 (+) 483 WP_050842995.1 ArpU family phage packaging/lysis transcriptional regulator -
  CGZ63_RS02140 - 379357..379899 (+) 543 WP_001012146.1 site-specific integrase -
  CGZ63_RS02150 - 380542..380913 (+) 372 WP_089607199.1 hypothetical protein -
  CGZ63_RS02155 - 381029..381247 (+) 219 WP_089607200.1 hypothetical protein -
  CGZ63_RS02160 - 381249..381575 (+) 327 WP_016097753.1 helix-turn-helix domain-containing protein -
  CGZ63_RS02165 - 381541..381876 (+) 336 WP_016097754.1 HNH endonuclease -
  CGZ63_RS02170 - 381999..382310 (+) 312 WP_089607201.1 P27 family phage terminase small subunit -
  CGZ63_RS02175 - 382307..383974 (+) 1668 WP_089607202.1 terminase TerL endonuclease subunit -
  CGZ63_RS02180 - 383983..385128 (+) 1146 WP_016125870.1 phage portal protein -
  CGZ63_RS02185 - 385128..385871 (+) 744 WP_086421921.1 head maturation protease, ClpP-related -
  CGZ63_RS02190 - 385875..387029 (+) 1155 WP_044796924.1 phage major capsid protein -
  CGZ63_RS02195 - 387035..387328 (+) 294 WP_086404942.1 hypothetical protein -
  CGZ63_RS02200 - 387330..387704 (+) 375 WP_086404943.1 phage head closure protein -
  CGZ63_RS02205 - 387692..388129 (+) 438 WP_089607203.1 HK97-gp10 family putative phage morphogenesis protein -
  CGZ63_RS02210 - 388126..388488 (+) 363 WP_000787877.1 DUF3168 domain-containing protein -
  CGZ63_RS02215 - 388504..389088 (+) 585 WP_089607204.1 major tail protein -
  CGZ63_RS02220 - 389145..389519 (+) 375 WP_086404946.1 hypothetical protein -
  CGZ63_RS02225 - 389684..394681 (+) 4998 WP_089607205.1 phage tail tape measure protein -
  CGZ63_RS02230 - 394721..396178 (+) 1458 WP_089607206.1 distal tail protein Dit -
  CGZ63_RS02235 - 396175..400635 (+) 4461 WP_089607207.1 phage tail spike protein -
  CGZ63_RS02240 - 400651..401025 (+) 375 WP_089607208.1 hypothetical protein -
  CGZ63_RS02245 - 401117..401353 (+) 237 WP_000398730.1 hemolysin XhlA family protein -
  CGZ63_RS02250 - 401353..401592 (+) 240 WP_000461723.1 hypothetical protein -
  CGZ63_RS02255 - 401589..402653 (+) 1065 WP_089607209.1 N-acetylmuramoyl-L-alanine amidase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10035.63 Da        Isoelectric Point: 7.1681

>NTDB_id=239537 CGZ63_RS02035 WP_089607186.1 371334..371612(+) (abrB) [Bacillus cereus C1L]
MKNTGVSRKVDELGRVVIPVELRRNLGIAEGTPLGFHVEGENIVLRKQDKSCFVTGKVSESNMELLDGRMFLSKEGATEL
LGILEKSGIVHG

Nucleotide


Download         Length: 279 bp        

>NTDB_id=239537 CGZ63_RS02035 WP_089607186.1 371334..371612(+) (abrB) [Bacillus cereus C1L]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAGTAGAGTTACGCAGAAATTTAGG
AATTGCTGAAGGTACACCATTAGGCTTTCATGTTGAAGGTGAAAACATCGTTTTAAGAAAACAGGATAAGTCATGCTTTG
TTACGGGTAAAGTTTCTGAATCAAACATGGAATTGTTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGGCATTCTTGAAAAGAGTGGAATCGTACATGGCTAA

Domains

Predicted by InterproScan.

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-48)

AbrB C-terminal domain (AbrB_C)

(52-86)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.762

91.304

0.5

Multiple sequence alignment