Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   C7M16_RS11155 Genome accession   NZ_CP028201
Coordinates   2235790..2236173 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM102753     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2230790..2241173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C7M16_RS11115 (C7M16_02194) sinI 2231723..2231896 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  C7M16_RS11120 (C7M16_02195) sinR 2231930..2232265 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C7M16_RS11125 (C7M16_02196) tasA 2232358..2233143 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  C7M16_RS11130 (C7M16_02197) sipW 2233207..2233779 (-) 573 WP_003246088.1 signal peptidase I SipW -
  C7M16_RS11135 (C7M16_02198) tapA 2233763..2234524 (-) 762 WP_160221678.1 amyloid fiber anchoring/assembly protein TapA -
  C7M16_RS11140 (C7M16_02199) yqzG 2234796..2235122 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  C7M16_RS11145 (C7M16_02200) spoIITA 2235164..2235343 (-) 180 WP_014480252.1 YqzE family protein -
  C7M16_RS11150 (C7M16_02201) comGG 2235415..2235789 (-) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  C7M16_RS11155 comGF 2235790..2236173 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C7M16_RS11160 (C7M16_02203) comGE 2236199..2236546 (-) 348 WP_033884703.1 ComG operon protein 5 Machinery gene
  C7M16_RS11165 (C7M16_02204) comGD 2236530..2236961 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  C7M16_RS11170 (C7M16_02205) comGC 2236951..2237247 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  C7M16_RS11175 (C7M16_02206) comGB 2237261..2238298 (-) 1038 WP_072175548.1 comG operon protein ComGB Machinery gene
  C7M16_RS11180 (C7M16_02207) comGA 2238285..2239355 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  C7M16_RS11185 (C7M16_02209) - 2239583..2239765 (-) 183 WP_033884706.1 hypothetical protein -
  C7M16_RS11190 (C7M16_02210) corA 2239767..2240720 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=239461 C7M16_RS11155 WP_032726158.1 2235790..2236173(-) (comGF) [Bacillus subtilis strain SRCM102753]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=239461 C7M16_RS11155 WP_032726158.1 2235790..2236173(-) (comGF) [Bacillus subtilis strain SRCM102753]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment