Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   CCX84_RS12670 Genome accession   NZ_CP022345
Coordinates   2352613..2352891 (-) Length   92 a.a.
NCBI ID   WP_000799096.1    Uniprot ID   B7H5R2
Organism   Bacillus thuringiensis strain c25     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2322116..2362935 2352613..2352891 within 0


Gene organization within MGE regions


Location: 2322116..2362935
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CCX84_RS12495 - 2322116..2323051 (-) 936 WP_061139234.1 N-acetylmuramoyl-L-alanine amidase -
  CCX84_RS12500 - 2323051..2323476 (-) 426 WP_061139235.1 phage holin family protein -
  CCX84_RS12505 - 2323516..2327547 (-) 4032 WP_061139236.1 phage tail spike protein -
  CCX84_RS12510 - 2327544..2329025 (-) 1482 WP_089455241.1 distal tail protein Dit -
  CCX84_RS12515 - 2329040..2332891 (-) 3852 WP_089455242.1 phage tail tape measure protein -
  CCX84_RS30150 - 2332907..2333083 (-) 177 WP_000344056.1 hypothetical protein -
  CCX84_RS12520 - 2333113..2333430 (-) 318 WP_000779162.1 hypothetical protein -
  CCX84_RS12525 - 2333480..2334085 (-) 606 WP_000896776.1 major tail protein -
  CCX84_RS12530 - 2334086..2334445 (-) 360 WP_089455243.1 DUF3168 domain-containing protein -
  CCX84_RS12535 - 2334442..2334876 (-) 435 WP_060851857.1 HK97-gp10 family putative phage morphogenesis protein -
  CCX84_RS12540 - 2334869..2335192 (-) 324 WP_065212684.1 phage head closure protein -
  CCX84_RS12545 - 2335179..2335466 (-) 288 WP_000244589.1 head-tail connector protein -
  CCX84_RS12550 - 2335487..2336659 (-) 1173 WP_000357562.1 phage major capsid protein -
  CCX84_RS12555 - 2336697..2337407 (-) 711 WP_001259165.1 head maturation protease, ClpP-related -
  CCX84_RS12560 - 2337394..2338647 (-) 1254 WP_061139237.1 phage portal protein -
  CCX84_RS12565 - 2338836..2340530 (-) 1695 WP_061139238.1 terminase TerL endonuclease subunit -
  CCX84_RS12570 - 2340532..2341035 (-) 504 WP_082769931.1 phage terminase small subunit P27 family -
  CCX84_RS12575 - 2341165..2341542 (-) 378 WP_061139239.1 HNH endonuclease -
  CCX84_RS12580 - 2341532..2341786 (-) 255 WP_061139240.1 hypothetical protein -
  CCX84_RS12585 - 2341923..2342135 (-) 213 WP_061139241.1 hypothetical protein -
  CCX84_RS12590 - 2342122..2342475 (-) 354 WP_061139242.1 hypothetical protein -
  CCX84_RS12600 - 2343276..2344226 (-) 951 WP_061139243.1 nucleoside hydrolase -
  CCX84_RS12605 - 2344441..2344983 (-) 543 WP_061139244.1 site-specific integrase -
  CCX84_RS12610 - 2344983..2345465 (-) 483 WP_061139245.1 ArpU family phage packaging/lysis transcriptional regulator -
  CCX84_RS30425 - 2345493..2345663 (-) 171 WP_071740169.1 hypothetical protein -
  CCX84_RS12620 - 2345762..2345950 (-) 189 WP_061139246.1 hypothetical protein -
  CCX84_RS12625 - 2345971..2346093 (-) 123 WP_071740168.1 DUF3983 domain-containing protein -
  CCX84_RS12630 - 2346140..2346304 (-) 165 WP_232487800.1 hypothetical protein -
  CCX84_RS12635 - 2346367..2346648 (-) 282 WP_061139248.1 hypothetical protein -
  CCX84_RS12640 - 2348641..2348928 (+) 288 WP_044585247.1 DUF4183 domain-containing protein -
  CCX84_RS12645 - 2350334..2351122 (+) 789 Protein_2403 sulfotransferase family 2 domain-containing protein -
  CCX84_RS12650 - 2351268..2351777 (-) 510 WP_061139249.1 dUTP diphosphatase -
  CCX84_RS12655 - 2351797..2352048 (-) 252 WP_000109494.1 hypothetical protein -
  CCX84_RS12660 - 2352075..2352242 (-) 168 WP_000717828.1 DUF3954 domain-containing protein -
  CCX84_RS12665 - 2352261..2352620 (-) 360 WP_001125968.1 hypothetical protein -
  CCX84_RS12670 abrB 2352613..2352891 (-) 279 WP_000799096.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  CCX84_RS12675 - 2352908..2353102 (-) 195 WP_000337979.1 hypothetical protein -
  CCX84_RS12680 - 2353118..2353993 (-) 876 WP_061139250.1 ATP-binding protein -
  CCX84_RS12685 - 2353932..2354678 (-) 747 WP_061139251.1 DnaD domain protein -
  CCX84_RS30430 - 2354683..2354859 (-) 177 WP_000281548.1 hypothetical protein -
  CCX84_RS30435 - 2354889..2355053 (-) 165 WP_000390298.1 hypothetical protein -
  CCX84_RS12700 - 2355053..2355319 (-) 267 WP_000522024.1 helix-turn-helix domain-containing protein -
  CCX84_RS30755 - 2355378..2355440 (-) 63 Protein_2415 hypothetical protein -
  CCX84_RS12710 - 2355535..2355831 (-) 297 WP_061139252.1 helix-turn-helix transcriptional regulator -
  CCX84_RS12715 - 2356015..2356365 (+) 351 WP_000425256.1 helix-turn-helix transcriptional regulator -
  CCX84_RS30155 - 2356626..2356781 (-) 156 WP_000791664.1 hypothetical protein -
  CCX84_RS12720 - 2356808..2358015 (-) 1208 Protein_2419 AimR family lysis-lysogeny pheromone receptor -
  CCX84_RS12725 - 2358662..2359771 (+) 1110 WP_061139254.1 tyrosine-type recombinase/integrase -
  CCX84_RS12730 - 2359840..2360511 (-) 672 WP_061139255.1 DUF3962 domain-containing protein -
  CCX84_RS12735 - 2360821..2361306 (-) 486 WP_002063155.1 hypothetical protein -
  CCX84_RS12740 - 2361796..2362116 (-) 321 WP_001071364.1 heterocycloanthracin/sonorensin family bacteriocin -
  CCX84_RS12745 - 2362672..2362935 (-) 264 WP_002101034.1 DUF3937 family protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10012.54 Da        Isoelectric Point: 6.4652

>NTDB_id=238532 CCX84_RS12670 WP_000799096.1 2352613..2352891(-) (abrB) [Bacillus thuringiensis strain c25]
MKNTGVSRKVDELGRVVIPIELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGEVSETNIELLGGRMFLSKEGASEL
LNFIQKSGLADA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=238532 CCX84_RS12670 WP_000799096.1 2352613..2352891(-) (abrB) [Bacillus thuringiensis strain c25]
ATGAAAAACACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGTGTGGTAATTCCAATAGAGTTACGTAGAACTTTAGG
AATTGCTGAAGGTACAGCGTTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAAGTGAATTA
CTGAATTTTATTCAGAAGAGTGGGCTGGCAGATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB B7H5R2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60.92

94.565

0.576

Multiple sequence alignment