Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   CFN60_RS15060 Genome accession   NZ_CP022341
Coordinates   3051000..3051140 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 157     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3046000..3056140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CFN60_RS15035 (CFN60_15030) - 3046340..3046723 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  CFN60_RS15040 (CFN60_15035) comA 3046745..3047389 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  CFN60_RS15045 (CFN60_15040) comP 3047470..3049761 (-) 2292 WP_022553709.1 histidine kinase Regulator
  CFN60_RS15050 (CFN60_15045) comX 3049773..3049937 (-) 165 WP_007613432.1 competence pheromone ComX -
  CFN60_RS15055 (CFN60_15050) - 3049937..3050848 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  CFN60_RS15060 (CFN60_15055) degQ 3051000..3051140 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  CFN60_RS15070 (CFN60_15065) - 3051606..3051947 (+) 342 WP_014418765.1 hypothetical protein -
  CFN60_RS15075 (CFN60_15070) - 3051954..3053177 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  CFN60_RS15080 (CFN60_15075) - 3053307..3054773 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  CFN60_RS15085 (CFN60_15080) - 3054791..3055342 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  CFN60_RS15090 (CFN60_15085) - 3055439..3055837 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=238475 CFN60_RS15060 WP_003152043.1 3051000..3051140(-) (degQ) [Bacillus velezensis strain 157]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=238475 CFN60_RS15060 WP_003152043.1 3051000..3051140(-) (degQ) [Bacillus velezensis strain 157]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment