Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   C5P47_RS00695 Genome accession   NZ_CP028140
Coordinates   106665..106949 (+) Length   94 a.a.
NCBI ID   WP_002987779.1    Uniprot ID   A0A0H2USY2
Organism   Streptococcus pyogenes strain NGAS979     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 101665..111949
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C5P47_RS00670 (C5P47_00660) - 103611..103976 (+) 366 WP_002986560.1 DUF1033 family protein -
  C5P47_RS00675 (C5P47_00665) comGA 104069..105007 (+) 939 WP_002987773.1 competence type IV pilus ATPase ComGA Machinery gene
  C5P47_RS00680 (C5P47_00670) comGB 104943..105977 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  C5P47_RS00685 (C5P47_00675) comGC 105979..106305 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  C5P47_RS00690 (C5P47_00680) comGD 106280..106708 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  C5P47_RS00695 (C5P47_00685) comGE 106665..106949 (+) 285 WP_002987779.1 competence type IV pilus minor pilin ComGE Machinery gene
  C5P47_RS00700 (C5P47_00690) comGF 106942..107376 (+) 435 WP_002986542.1 competence type IV pilus minor pilin ComGF Machinery gene
  C5P47_RS00705 (C5P47_00695) comGG 107360..107686 (+) 327 WP_002992739.1 competence type IV pilus minor pilin ComGG -
  C5P47_RS00710 (C5P47_00700) comGH 107784..108737 (+) 954 WP_009880357.1 class I SAM-dependent methyltransferase Machinery gene
  C5P47_RS00715 (C5P47_00705) - 108796..109992 (+) 1197 WP_011284424.1 acetate kinase -
  C5P47_RS00720 (C5P47_00710) - 110179..110487 (+) 309 WP_011284425.1 hypothetical protein -
  C5P47_RS00725 (C5P47_00715) proC 110570..111340 (-) 771 WP_002992745.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10672.62 Da        Isoelectric Point: 8.9043

>NTDB_id=238300 C5P47_RS00695 WP_002987779.1 106665..106949(+) (comGE) [Streptococcus pyogenes strain NGAS979]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=238300 C5P47_RS00695 WP_002987779.1 106665..106949(+) (comGE) [Streptococcus pyogenes strain NGAS979]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATCGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTGAGCAGTTTACAGCAGAGTCAGGCTGCTTTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CTTTGATGGCAGTACAAACTAGAACTAAAGAGATGACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAT
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2USY2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383