Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | C7M53_RS17925 | Genome accession | NZ_CP027789 |
| Coordinates | 3373761..3373901 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain TAB7 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3368761..3378901
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7M53_RS17900 (C7M53_17875) | - | 3369032..3369421 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| C7M53_RS17905 (C7M53_17880) | comA | 3369438..3370076 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| C7M53_RS17910 (C7M53_17885) | comP | 3370163..3372484 (-) | 2322 | WP_026080865.1 | ATP-binding protein | Regulator |
| C7M53_RS17915 (C7M53_17890) | comX | 3372524..3372688 (-) | 165 | WP_011198251.1 | competence pheromone ComX | - |
| C7M53_RS17920 (C7M53_17895) | comQ | 3372703..3373572 (-) | 870 | WP_011198252.1 | polyprenyl synthetase family protein | Regulator |
| C7M53_RS17925 (C7M53_17900) | degQ | 3373761..3373901 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| C7M53_RS17935 (C7M53_17910) | - | 3374387..3374734 (+) | 348 | WP_009329512.1 | hypothetical protein | - |
| C7M53_RS17940 (C7M53_17915) | - | 3374777..3375997 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| C7M53_RS17945 (C7M53_17920) | - | 3376176..3377585 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| C7M53_RS17950 (C7M53_17925) | - | 3377663..3378214 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| C7M53_RS17955 (C7M53_17930) | - | 3378399..3378800 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=237444 C7M53_RS17925 WP_003184860.1 3373761..3373901(-) (degQ) [Bacillus licheniformis strain TAB7]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=237444 C7M53_RS17925 WP_003184860.1 3373761..3373901(-) (degQ) [Bacillus licheniformis strain TAB7]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATTTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |