Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BLI_RS16565 Genome accession   NC_006322
Coordinates   3210652..3210792 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis DSM 13 = ATCC 14580     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3205652..3215792
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BLI_RS16535 (BLi03354) - 3205766..3206953 (-) 1188 Protein_3273 sensor histidine kinase -
  BLI_RS16550 (BLi03357) - 3208224..3209375 (-) 1152 WP_227616443.1 PDZ domain-containing protein -
  BLI_RS16555 (BLi03358) comX 3209415..3209579 (-) 165 WP_011198251.1 competence pheromone ComX -
  BLI_RS16560 (BLi03359) - 3209594..3210463 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  BLI_RS16565 (BLi03360) degQ 3210652..3210792 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  BLI_RS16575 (BLi03361) - 3211278..3211625 (+) 348 WP_009329512.1 hypothetical protein -
  BLI_RS16580 (BLi03362) - 3211668..3212888 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  BLI_RS16585 (BLi03363) - 3213067..3214536 (-) 1470 WP_003184866.1 nicotinate phosphoribosyltransferase -
  BLI_RS16590 (BLi03364) - 3214554..3215105 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  BLI_RS16595 (BLi03365) - 3215290..3215691 (-) 402 WP_011201726.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=23739 BLI_RS16565 WP_003184860.1 3210652..3210792(-) (degQ) [Bacillus licheniformis DSM 13 = ATCC 14580]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=23739 BLI_RS16565 WP_003184860.1 3210652..3210792(-) (degQ) [Bacillus licheniformis DSM 13 = ATCC 14580]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment