Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BLI_RS13060 | Genome accession | NC_006322 |
| Coordinates | 2550337..2550513 (+) | Length | 58 a.a. |
| NCBI ID | WP_003183444.1 | Uniprot ID | - |
| Organism | Bacillus licheniformis DSM 13 = ATCC 14580 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2545337..2555513
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BLI_RS13040 (BLi02631) | gcvT | 2545979..2547073 (-) | 1095 | WP_003183436.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BLI_RS13050 (BLi02633) | - | 2547666..2549345 (+) | 1680 | WP_003183439.1 | DEAD/DEAH box helicase | - |
| BLI_RS13055 (BLi02634) | - | 2549352..2550146 (+) | 795 | WP_003183441.1 | YqhG family protein | - |
| BLI_RS13060 (BLi02635) | sinI | 2550337..2550513 (+) | 177 | WP_003183444.1 | anti-repressor SinI | Regulator |
| BLI_RS13065 (BLi02636) | sinR | 2550547..2550882 (+) | 336 | WP_006637528.1 | transcriptional regulator SinR | Regulator |
| BLI_RS13070 (BLi02637) | tasA | 2550987..2551781 (-) | 795 | WP_003183447.1 | biofilm matrix protein TasA | - |
| BLI_RS13075 (BLi02638) | sipW | 2551855..2552439 (-) | 585 | WP_003183449.1 | signal peptidase I SipW | - |
| BLI_RS13080 (BLi02639) | tapA | 2552436..2553164 (-) | 729 | WP_011198112.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BLI_RS13085 (BLi02640) | - | 2553441..2553761 (+) | 321 | WP_003183454.1 | YqzG/YhdC family protein | - |
| BLI_RS13090 (BLi02641) | - | 2553791..2553973 (-) | 183 | WP_003183456.1 | YqzE family protein | - |
| BLI_RS13095 (BLi02642) | comGG | 2554062..2554427 (-) | 366 | WP_003183459.1 | competence type IV pilus minor pilin ComGG | - |
| BLI_RS13100 (BLi02643) | comGF | 2554440..2554928 (-) | 489 | WP_011201694.1 | competence type IV pilus minor pilin ComGF | - |
| BLI_RS13105 (BLi02644) | comGE | 2554837..2555184 (-) | 348 | WP_009327907.1 | competence type IV pilus minor pilin ComGE | - |
Sequence
Protein
Download Length: 58 a.a. Molecular weight: 6724.47 Da Isoelectric Point: 4.7616
>NTDB_id=23723 BLI_RS13060 WP_003183444.1 2550337..2550513(+) (sinI) [Bacillus licheniformis DSM 13 = ATCC 14580]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
Nucleotide
Download Length: 177 bp
>NTDB_id=23723 BLI_RS13060 WP_003183444.1 2550337..2550513(+) (sinI) [Bacillus licheniformis DSM 13 = ATCC 14580]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
51.724 |
100 |
0.517 |