Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   CEP72_RS03135 Genome accession   NZ_CP022050
Coordinates   516214..516843 (-) Length   209 a.a.
NCBI ID   WP_000839159.1    Uniprot ID   A0AAV3HCB2
Organism   Escherichia coli O157 strain FDAARGOS_293     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 501737..528017 516214..516843 within 0


Gene organization within MGE regions


Location: 501737..528017
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CEP72_RS03065 (CEP72_03065) - 502995..504848 (+) 1854 Protein_556 3'-5' exoribonuclease -
  CEP72_RS03070 (CEP72_03070) - 504916..505158 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  CEP72_RS03075 (CEP72_03075) - 505136..506155 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  CEP72_RS03080 (CEP72_03080) yccA 506563..507222 (+) 660 WP_000375128.1 FtsH protease modulator YccA -
  CEP72_RS03085 (CEP72_03085) tusE 507313..507642 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  CEP72_RS03090 (CEP72_03090) yccX 507639..507917 (-) 279 WP_000048252.1 acylphosphatase -
  CEP72_RS03095 (CEP72_03095) rlmI 508012..509202 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  CEP72_RS03100 (CEP72_03100) hspQ 509260..509577 (+) 318 WP_001295356.1 heat shock protein HspQ -
  CEP72_RS03105 (CEP72_03105) yccU 509622..510035 (-) 414 WP_000665217.1 CoA-binding protein -
  CEP72_RS03110 (CEP72_03110) yccT 510208..510870 (+) 663 WP_000847791.1 DUF2057 family protein -
  CEP72_RS03115 (CEP72_03115) mgsA 510966..511424 (+) 459 WP_000424181.1 methylglyoxal synthase -
  CEP72_RS03120 (CEP72_03120) helD 511456..513510 (-) 2055 WP_001301436.1 DNA helicase IV -
  CEP72_RS03125 (CEP72_03125) yccF 513633..514079 (+) 447 WP_001261230.1 YccF domain-containing protein -
  CEP72_RS03130 (CEP72_03130) yccS 514089..516251 (+) 2163 WP_000875023.1 YccS family putative transporter -
  CEP72_RS03135 (CEP72_03135) sxy/tfoX 516214..516843 (-) 630 WP_000839159.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  CEP72_RS03140 (CEP72_03140) sulA 517062..517571 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  CEP72_RS03150 (CEP72_03150) ompA 517928..518968 (+) 1041 WP_000750416.1 porin OmpA -
  CEP72_RS03155 (CEP72_03155) matP 519044..519496 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  CEP72_RS03160 (CEP72_03160) ycbZ 519682..521442 (+) 1761 WP_000156526.1 Lon protease family protein -
  CEP72_RS03165 (CEP72_03165) fabA 521511..522029 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  CEP72_RS03170 (CEP72_03170) rmf 522099..522266 (-) 168 WP_000828648.1 ribosome modulation factor -
  CEP72_RS03175 (CEP72_03175) pqiC 522522..523085 (-) 564 WP_000759107.1 membrane integrity-associated transporter subunit PqiC -
  CEP72_RS03180 (CEP72_03180) pqiB 523082..524722 (-) 1641 WP_000445550.1 intermembrane transport protein PqiB -
  CEP72_RS03185 (CEP72_03185) pqiA 524727..525980 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  CEP72_RS03190 (CEP72_03190) uup 526110..528017 (-) 1908 WP_000053083.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24173.05 Da        Isoelectric Point: 9.1942

>NTDB_id=236206 CEP72_RS03135 WP_000839159.1 516214..516843(-) (sxy/tfoX) [Escherichia coli O157 strain FDAARGOS_293]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKYPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=236206 CEP72_RS03135 WP_000839159.1 516214..516843(-) (sxy/tfoX) [Escherichia coli O157 strain FDAARGOS_293]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAATATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment