Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | TRNA_RS34565 | Genome accession | NC_006270 |
| Coordinates | 2550484..2550660 (+) | Length | 58 a.a. |
| NCBI ID | WP_003183444.1 | Uniprot ID | - |
| Organism | Bacillus licheniformis DSM 13 = ATCC 14580 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2545484..2555660
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TRNA_RS34545 (BL01562) | gcvT | 2546126..2547220 (-) | 1095 | WP_003183436.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| TRNA_RS34555 (BL01550) | - | 2547813..2549492 (+) | 1680 | WP_003183439.1 | DEAD/DEAH box helicase | - |
| TRNA_RS34560 (BL01551) | - | 2549499..2550293 (+) | 795 | WP_003183441.1 | YqhG family protein | - |
| TRNA_RS34565 (BL05264) | sinI | 2550484..2550660 (+) | 177 | WP_003183444.1 | anti-repressor SinI | Regulator |
| TRNA_RS34570 (BL01552) | sinR | 2550694..2551029 (+) | 336 | WP_006637528.1 | transcriptional regulator SinR | Regulator |
| TRNA_RS34575 (BL01563) | tasA | 2551134..2551928 (-) | 795 | WP_003183447.1 | biofilm matrix protein TasA | - |
| TRNA_RS34580 (BL01564) | sipW | 2552002..2552586 (-) | 585 | WP_003183449.1 | signal peptidase I SipW | - |
| TRNA_RS34585 (BL01565) | tapA | 2552583..2553311 (-) | 729 | WP_011198112.1 | amyloid fiber anchoring/assembly protein TapA | - |
| TRNA_RS34590 (BL01553) | - | 2553588..2553908 (+) | 321 | WP_003183454.1 | YqzG/YhdC family protein | - |
| TRNA_RS34595 (BL05265) | - | 2553938..2554120 (-) | 183 | WP_003183456.1 | YqzE family protein | - |
| TRNA_RS34600 (BL01566) | comGG | 2554209..2554574 (-) | 366 | WP_003183459.1 | competence type IV pilus minor pilin ComGG | - |
| TRNA_RS34605 (BL01567) | comGF | 2554587..2555075 (-) | 489 | WP_011201694.1 | competence type IV pilus minor pilin ComGF | - |
| TRNA_RS34610 (BL01568) | comGE | 2554984..2555331 (-) | 348 | WP_009327907.1 | competence type IV pilus minor pilin ComGE | - |
Sequence
Protein
Download Length: 58 a.a. Molecular weight: 6724.47 Da Isoelectric Point: 4.7616
>NTDB_id=23577 TRNA_RS34565 WP_003183444.1 2550484..2550660(+) (sinI) [Bacillus licheniformis DSM 13 = ATCC 14580]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF
Nucleotide
Download Length: 177 bp
>NTDB_id=23577 TRNA_RS34565 WP_003183444.1 2550484..2550660(+) (sinI) [Bacillus licheniformis DSM 13 = ATCC 14580]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
51.724 |
100 |
0.517 |