Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | S101392_RS13415 | Genome accession | NZ_CP021921 |
| Coordinates | 2601550..2601960 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. subtilis strain SRCM101392 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2596918..2640219 | 2601550..2601960 | within | 0 |
Gene organization within MGE regions
Location: 2596918..2640219
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S101392_RS13390 (S101392_02669) | yqeF | 2597085..2597816 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| S101392_RS13395 (S101392_02670) | cwlH | 2598068..2598820 (-) | 753 | WP_088326549.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| S101392_RS13400 | yqeD | 2599007..2599632 (+) | 626 | Protein_2601 | TVP38/TMEM64 family protein | - |
| S101392_RS13405 (S101392_02672) | gnd | 2599651..2600544 (-) | 894 | WP_043857850.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| S101392_RS13410 (S101392_02673) | yqeB | 2600796..2601517 (+) | 722 | Protein_2603 | DUF308 domain-containing protein | - |
| S101392_RS13415 (S101392_02674) | nucA/comI | 2601550..2601960 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| S101392_RS13420 (S101392_02675) | - | 2602156..2602506 (+) | 351 | Protein_2605 | sigma-70 family RNA polymerase sigma factor | - |
| S101392_RS13425 (S101392_02676) | - | 2602646..2603116 (+) | 471 | WP_033884465.1 | MarR family transcriptional regulator | - |
| S101392_RS13430 (S101392_02677) | - | 2603267..2604679 (+) | 1413 | WP_088326553.1 | MDR family MFS transporter | - |
| S101392_RS13435 (S101392_02678) | spoIVCA | 2604866..2606326 (-) | 1461 | WP_250621315.1 | site-specific DNA recombinase SpoIVCA | - |
| S101392_RS21905 | - | 2606284..2606462 (-) | 179 | Protein_2609 | hypothetical protein | - |
| S101392_RS13445 (S101392_02679) | - | 2607106..2608203 (-) | 1098 | WP_032726210.1 | glycosyl hydrolase | - |
| S101392_RS13460 (S101392_02683) | - | 2609038..2610168 (-) | 1131 | WP_041850195.1 | hypothetical protein | - |
| S101392_RS21910 | - | 2610562..2610642 (+) | 81 | Protein_2612 | RNA polymerase subunit sigma | - |
| S101392_RS13465 (S101392_02685) | - | 2610948..2611622 (+) | 675 | WP_015251663.1 | TraX family protein | - |
| S101392_RS13470 (S101392_02686) | phrE | 2611761..2611895 (+) | 135 | WP_088326558.1 | phosphatase RapE inhibitor PhrE | - |
| S101392_RS13475 | - | 2612005..2612164 (+) | 160 | Protein_2615 | hypothetical protein | - |
| S101392_RS13480 (S101392_02688) | - | 2612533..2614299 (+) | 1767 | WP_088326561.1 | T7SS effector LXG polymorphic toxin | - |
| S101392_RS13485 (S101392_02689) | - | 2614313..2614777 (+) | 465 | WP_088326564.1 | SMI1/KNR4 family protein | - |
| S101392_RS13490 (S101392_02690) | - | 2614980..2615702 (-) | 723 | WP_015251658.1 | NPP1 family protein | - |
| S101392_RS13500 (S101392_02691) | - | 2615896..2616860 (-) | 965 | Protein_2619 | N-acetylmuramoyl-L-alanine amidase | - |
| S101392_RS13505 | - | 2616905..2617045 (-) | 141 | Protein_2620 | phage holin family protein | - |
| S101392_RS13510 (S101392_02692) | - | 2617072..2617257 (-) | 186 | Protein_2621 | phage terminase large subunit | - |
| S101392_RS13515 | terS | 2617254..2618022 (-) | 769 | Protein_2622 | phage terminase small subunit | - |
| S101392_RS13520 | - | 2618203..2618289 (+) | 87 | WP_073991391.1 | YjcZ family sporulation protein | - |
| S101392_RS13525 (S101392_02695) | - | 2618330..2618422 (+) | 93 | WP_088326573.1 | YjcZ family sporulation protein | - |
| S101392_RS13530 (S101392_02696) | cotD | 2618610..2618825 (-) | 216 | WP_076458314.1 | spore coat protein CotD | - |
| S101392_RS13535 (S101392_02697) | yqaQ | 2619383..2619831 (-) | 449 | Protein_2626 | sigma-70 family RNA polymerase sigma factor | - |
| S101392_RS13540 (S101392_02698) | - | 2619928..2620800 (-) | 873 | WP_088326576.1 | hypothetical protein | - |
| S101392_RS13545 (S101392_02699) | - | 2621156..2621422 (+) | 267 | WP_088326578.1 | transcriptional regulator | - |
| S101392_RS13550 (S101392_02700) | yqaO | 2621562..2621768 (-) | 207 | WP_088326580.1 | XtrA/YqaO family protein | - |
| S101392_RS13555 (S101392_02701) | yqaN | 2621850..2622278 (-) | 429 | WP_088326582.1 | RusA family crossover junction endodeoxyribonuclease | - |
| S101392_RS13560 (S101392_02702) | - | 2622374..2622523 (-) | 150 | WP_088326584.1 | hypothetical protein | - |
| S101392_RS13565 (S101392_02703) | - | 2622514..2622801 (-) | 288 | Protein_2632 | ATP-binding protein | - |
| S101392_RS13570 (S101392_02704) | - | 2622994..2623395 (-) | 402 | WP_053216511.1 | hypothetical protein | - |
| S101392_RS13575 (S101392_02705) | - | 2623818..2624660 (+) | 843 | WP_088326586.1 | sialate O-acetylesterase | - |
| S101392_RS13580 (S101392_02706) | - | 2624657..2625199 (+) | 543 | WP_015251647.1 | PadR family transcriptional regulator | - |
| S101392_RS13585 (S101392_02707) | yqaC | 2625395..2625931 (-) | 537 | WP_088326588.1 | AAA family ATPase | - |
| S101392_RS13590 | - | 2626086..2626572 (+) | 487 | Protein_2637 | ImmA/IrrE family metallo-endopeptidase | - |
| S101392_RS13595 (S101392_02708) | - | 2626571..2626964 (+) | 394 | Protein_2638 | sigma-70 family RNA polymerase sigma factor | - |
| S101392_RS13600 (S101392_02709) | - | 2627534..2628214 (-) | 681 | WP_046381200.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| S101392_RS13605 (S101392_02710) | - | 2628345..2629688 (+) | 1344 | WP_088326590.1 | MATE family efflux transporter | - |
| S101392_RS13610 (S101392_02711) | - | 2630174..2631259 (-) | 1086 | WP_088326592.1 | glycosyl hydrolase | - |
| S101392_RS13615 (S101392_02712) | yrkJ | 2632045..2632830 (-) | 786 | WP_088326594.1 | sulfite exporter TauE/SafE family protein | - |
| S101392_RS13620 (S101392_02713) | yrkI | 2632891..2633118 (-) | 228 | WP_088326596.1 | sulfurtransferase TusA family protein | - |
| S101392_RS13625 (S101392_02714) | yrkH | 2633152..2634286 (-) | 1135 | Protein_2644 | MBL fold metallo-hydrolase | - |
| S101392_RS21510 | - | 2634316..2634600 (-) | 285 | Protein_2645 | DsrE/DsrF/DrsH-like family protein | - |
| S101392_RS13635 (S101392_02715) | yrkF | 2634621..2635178 (-) | 558 | WP_048655089.1 | sulfurtransferase TusA family protein | - |
| S101392_RS21915 | - | 2635243..2635339 (-) | 97 | Protein_2647 | rhodanese-like domain-containing protein | - |
| S101392_RS13645 (S101392_02716) | yrkE | 2635363..2635844 (-) | 482 | Protein_2648 | DsrE/DsrF/DrsH-like family protein | - |
| S101392_RS13650 (S101392_02717) | yrkD | 2635993..2636253 (-) | 261 | WP_003237170.1 | metal-sensitive transcriptional regulator | - |
| S101392_RS21920 | - | 2636275..2636592 (-) | 318 | WP_015251633.1 | hypothetical protein | - |
| S101392_RS13665 (S101392_02718) | yrkC | 2636976..2637536 (-) | 561 | WP_046663781.1 | cupin domain-containing protein | - |
| S101392_RS13675 | - | 2637762..2637905 (-) | 144 | WP_032722385.1 | hypothetical protein | - |
| S101392_RS21925 | - | 2637883..2638014 (-) | 132 | Protein_2653 | hypothetical protein | - |
| S101392_RS13680 (S101392_02719) | bltR | 2638079..2638900 (-) | 822 | WP_088326598.1 | multidrug efflux transcriptional regulator BltR | - |
| S101392_RS13685 (S101392_02720) | blt | 2639017..2640219 (+) | 1203 | WP_029727180.1 | multidrug efflux MFS transporter Blt | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=234977 S101392_RS13415 WP_009967785.1 2601550..2601960(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain SRCM101392]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=234977 S101392_RS13415 WP_009967785.1 2601550..2601960(-) (nucA/comI) [Bacillus subtilis subsp. subtilis strain SRCM101392]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTACCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |