Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   S101392_RS06160 Genome accession   NZ_CP021921
Coordinates   1186996..1187187 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain SRCM101392     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1181996..1192187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101392_RS06130 (S101392_01213) argF 1182861..1183820 (+) 960 WP_088325579.1 ornithine carbamoyltransferase -
  S101392_RS06135 (S101392_01214) yjzC 1183906..1184085 (+) 180 WP_003245356.1 YjzC family protein -
  S101392_RS06140 (S101392_01215) yjzD 1184131..1184316 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  S101392_RS06145 (S101392_01216) - 1184565..1185299 (+) 735 WP_088325581.1 hypothetical protein -
  S101392_RS06150 (S101392_01217) - 1185381..1185938 (+) 558 WP_014479435.1 hypothetical protein -
  S101392_RS06155 (S101392_01218) med 1186028..1186981 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  S101392_RS06160 (S101392_01219) comZ 1186996..1187187 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  S101392_RS06165 (S101392_01220) yjzB 1187217..1187456 (-) 240 WP_003232972.1 spore coat protein YjzB -
  S101392_RS06170 (S101392_01221) fabH 1187621..1188559 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  S101392_RS06175 (S101392_01222) fabF 1188582..1189823 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  S101392_RS06180 (S101392_01223) yjaZ 1189899..1190684 (+) 786 WP_032721346.1 DUF2268 domain-containing protein -
  S101392_RS06185 (S101392_01224) appD 1190876..1191862 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=234946 S101392_RS06160 WP_003224559.1 1186996..1187187(+) (comZ) [Bacillus subtilis subsp. subtilis strain SRCM101392]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=234946 S101392_RS06160 WP_003224559.1 1186996..1187187(+) (comZ) [Bacillus subtilis subsp. subtilis strain SRCM101392]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment