Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | S101395_RS03770 | Genome accession | NZ_CP021920 |
| Coordinates | 726781..727065 (+) | Length | 94 a.a. |
| NCBI ID | WP_006639122.1 | Uniprot ID | - |
| Organism | Bacillus sonorensis strain SRCM101395 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 721927..774690 | 726781..727065 | within | 0 |
Gene organization within MGE regions
Location: 721927..774690
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| S101395_RS03735 (S101395_00749) | - | 721927..723069 (+) | 1143 | WP_006639129.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
| S101395_RS03740 (S101395_00750) | - | 723086..723739 (+) | 654 | WP_006639128.1 | ABC transporter permease | - |
| S101395_RS03745 (S101395_00751) | opuCC | 723753..724670 (+) | 918 | WP_006639127.1 | osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC | - |
| S101395_RS03750 (S101395_00752) | - | 724689..725366 (+) | 678 | WP_006639126.1 | ABC transporter permease | - |
| S101395_RS03755 (S101395_00753) | - | 725410..725808 (-) | 399 | WP_029419541.1 | helix-turn-helix domain-containing protein | - |
| S101395_RS03760 (S101395_00754) | - | 725961..726365 (-) | 405 | WP_006639124.1 | helix-turn-helix domain-containing protein | - |
| S101395_RS03765 (S101395_00755) | - | 726521..726751 (+) | 231 | WP_006639123.1 | helix-turn-helix domain-containing protein | - |
| S101395_RS03770 (S101395_00756) | abrB | 726781..727065 (+) | 285 | WP_006639122.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| S101395_RS03775 (S101395_00757) | secG | 727225..727455 (+) | 231 | WP_006639121.1 | preprotein translocase subunit SecG | - |
| S101395_RS03780 (S101395_00758) | - | 727586..728332 (+) | 747 | WP_006639120.1 | alpha/beta hydrolase | - |
| S101395_RS03785 (S101395_00759) | rnr | 728346..730640 (+) | 2295 | WP_088272687.1 | ribonuclease R | - |
| S101395_RS03790 (S101395_00760) | smpB | 730753..731226 (+) | 474 | WP_006639118.1 | SsrA-binding protein | - |
| S101395_RS03800 (S101395_00761) | - | 731780..732874 (-) | 1095 | WP_003185410.1 | tyrosine-type recombinase/integrase | - |
| S101395_RS03805 (S101395_00762) | - | 732945..733595 (-) | 651 | WP_016886531.1 | LexA family protein | - |
| S101395_RS03810 (S101395_00763) | - | 733752..733991 (+) | 240 | WP_044789338.1 | helix-turn-helix domain-containing protein | - |
| S101395_RS03815 (S101395_00764) | - | 734006..734275 (+) | 270 | WP_016886533.1 | hypothetical protein | - |
| S101395_RS03820 (S101395_00765) | - | 734238..734555 (-) | 318 | WP_016886534.1 | hypothetical protein | - |
| S101395_RS03825 (S101395_00766) | - | 734617..735411 (+) | 795 | WP_003185404.1 | ORF6N domain-containing protein | - |
| S101395_RS03830 (S101395_00767) | - | 735408..735596 (+) | 189 | WP_003185403.1 | helix-turn-helix transcriptional regulator | - |
| S101395_RS03835 (S101395_00768) | - | 735728..735916 (+) | 189 | WP_016886536.1 | hypothetical protein | - |
| S101395_RS03840 (S101395_00769) | - | 735974..736528 (+) | 555 | WP_088272688.1 | hypothetical protein | - |
| S101395_RS25145 (S101395_00771) | - | 736680..736844 (+) | 165 | WP_017474700.1 | hypothetical protein | - |
| S101395_RS03845 (S101395_00772) | - | 736831..737121 (-) | 291 | WP_017474699.1 | hypothetical protein | - |
| S101395_RS25150 (S101395_00773) | - | 737177..737332 (+) | 156 | WP_155759051.1 | hypothetical protein | - |
| S101395_RS03850 (S101395_00774) | - | 737379..737624 (+) | 246 | WP_048407027.1 | hypothetical protein | - |
| S101395_RS03855 (S101395_00775) | - | 737696..738010 (-) | 315 | WP_048406869.1 | hypothetical protein | - |
| S101395_RS03860 (S101395_00776) | - | 738065..738331 (+) | 267 | WP_009330095.1 | YqaH family protein | - |
| S101395_RS03865 (S101395_00778) | - | 738419..738661 (+) | 243 | WP_011198322.1 | hypothetical protein | - |
| S101395_RS03870 (S101395_00779) | - | 738761..739318 (+) | 558 | WP_088272689.1 | host-nuclease inhibitor Gam family protein | - |
| S101395_RS03875 (S101395_00780) | - | 739322..740254 (+) | 933 | WP_061565941.1 | AAA family ATPase | - |
| S101395_RS03880 (S101395_00781) | - | 740254..740691 (+) | 438 | WP_061576092.1 | DUF669 domain-containing protein | - |
| S101395_RS03885 (S101395_00782) | - | 740752..743184 (+) | 2433 | WP_069500785.1 | phage/plasmid primase, P4 family | - |
| S101395_RS03890 (S101395_00783) | - | 743460..743723 (+) | 264 | WP_025807631.1 | hypothetical protein | - |
| S101395_RS03895 (S101395_00784) | - | 743701..744138 (+) | 438 | WP_025807629.1 | hypothetical protein | - |
| S101395_RS03900 (S101395_00785) | - | 744135..744674 (+) | 540 | WP_025807627.1 | ERCC4 domain-containing protein | - |
| S101395_RS03905 (S101395_00786) | - | 744671..744841 (+) | 171 | WP_071583658.1 | Fur-regulated basic protein FbpA | - |
| S101395_RS03910 (S101395_00787) | - | 744838..745359 (+) | 522 | WP_244185783.1 | putative metallopeptidase | - |
| S101395_RS03915 (S101395_00788) | - | 745375..745752 (+) | 378 | WP_088272690.1 | YopX family protein | - |
| S101395_RS03920 (S101395_00790) | - | 745865..746245 (+) | 381 | WP_088272691.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| S101395_RS03925 (S101395_00791) | - | 746670..747317 (+) | 648 | WP_048407182.1 | hypothetical protein | - |
| S101395_RS25850 (S101395_00792) | - | 747451..747768 (+) | 318 | WP_244185784.1 | hypothetical protein | - |
| S101395_RS03935 (S101395_00793) | - | 747795..748169 (+) | 375 | WP_088272692.1 | HNH endonuclease | - |
| S101395_RS03945 (S101395_00794) | - | 748401..748916 (+) | 516 | WP_069500782.1 | phage terminase small subunit P27 family | - |
| S101395_RS03950 (S101395_00795) | - | 748913..750622 (+) | 1710 | WP_088272693.1 | terminase large subunit | - |
| S101395_RS03955 (S101395_00796) | - | 750634..750825 (+) | 192 | WP_057957701.1 | DUF1056 family protein | - |
| S101395_RS03960 (S101395_00797) | - | 750826..752136 (+) | 1311 | WP_088272694.1 | phage portal protein | - |
| S101395_RS03965 (S101395_00798) | - | 752081..752812 (+) | 732 | WP_088272695.1 | head maturation protease, ClpP-related | - |
| S101395_RS03970 (S101395_00799) | - | 752851..754134 (+) | 1284 | WP_080624104.1 | phage major capsid protein | - |
| S101395_RS03975 (S101395_00800) | - | 754158..754586 (+) | 429 | WP_006637246.1 | collagen-like protein | - |
| S101395_RS03980 (S101395_00801) | - | 754607..754909 (+) | 303 | WP_006637247.1 | head-tail connector protein | - |
| S101395_RS03985 (S101395_00802) | - | 754899..755207 (+) | 309 | WP_006637248.1 | phage head closure protein | - |
| S101395_RS03990 (S101395_00803) | - | 755207..755605 (+) | 399 | WP_006637249.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| S101395_RS03995 (S101395_00804) | - | 755602..755985 (+) | 384 | WP_003185344.1 | hypothetical protein | - |
| S101395_RS04000 (S101395_00805) | - | 756000..756617 (+) | 618 | WP_088272696.1 | major tail protein | - |
| S101395_RS04005 (S101395_00806) | gpG | 756674..757039 (+) | 366 | WP_088272697.1 | phage tail assembly chaperone G | - |
| S101395_RS04010 (S101395_00808) | - | 757248..761714 (+) | 4467 | WP_088272698.1 | phage tail tape measure protein | - |
| S101395_RS04015 (S101395_00809) | - | 761714..762550 (+) | 837 | WP_048406906.1 | phage tail family protein | - |
| S101395_RS04020 (S101395_00810) | - | 762563..764275 (+) | 1713 | WP_088272699.1 | phage tail protein | - |
| S101395_RS04025 (S101395_00811) | - | 764310..766877 (+) | 2568 | WP_088272700.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| S101395_RS04030 (S101395_00812) | - | 766890..768212 (+) | 1323 | WP_208620347.1 | phage baseplate upper protein | - |
| S101395_RS04035 (S101395_00813) | - | 768227..768544 (+) | 318 | WP_088272701.1 | hypothetical protein | - |
| S101395_RS04040 (S101395_00814) | - | 768541..768723 (+) | 183 | WP_048407282.1 | XkdX family protein | - |
| S101395_RS04045 (S101395_00815) | - | 768786..769055 (+) | 270 | WP_048407283.1 | hemolysin XhlA family protein | - |
| S101395_RS04050 (S101395_00816) | - | 769071..769334 (+) | 264 | WP_088272702.1 | phage holin | - |
| S101395_RS04055 (S101395_00817) | - | 769381..770334 (+) | 954 | WP_088272703.1 | glycoside hydrolase family 25 protein | - |
| S101395_RS04060 (S101395_00818) | - | 770384..770800 (-) | 417 | WP_088272704.1 | immunity 70 family protein | - |
| S101395_RS04065 (S101395_00819) | - | 770807..772462 (-) | 1656 | WP_088272705.1 | ribonuclease YeeF family protein | - |
| S101395_RS04070 (S101395_00821) | - | 773016..773276 (+) | 261 | WP_088272706.1 | helix-turn-helix domain-containing protein | - |
| S101395_RS04075 (S101395_00822) | - | 773392..773862 (+) | 471 | WP_088272707.1 | Panacea domain-containing protein | - |
| S101395_RS04080 (S101395_00823) | - | 773862..774296 (+) | 435 | WP_088272708.1 | hypothetical protein | - |
| S101395_RS04085 (S101395_00824) | - | 774322..774690 (-) | 369 | WP_182423286.1 | YolD-like family protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10487.30 Da Isoelectric Point: 7.9636
>NTDB_id=234873 S101395_RS03770 WP_006639122.1 726781..727065(+) (abrB) [Bacillus sonorensis strain SRCM101395]
MKNTGIVRRIDELGRVVLPVELRRVLNIKEKDPLEIYSDGDNIILAKYAANMACLMTGEITTQNKTYAGGKIILSPRGAE
MLLEDLLEALSNRK
MKNTGIVRRIDELGRVVLPVELRRVLNIKEKDPLEIYSDGDNIILAKYAANMACLMTGEITTQNKTYAGGKIILSPRGAE
MLLEDLLEALSNRK
Nucleotide
Download Length: 285 bp
>NTDB_id=234873 S101395_RS03770 WP_006639122.1 726781..727065(+) (abrB) [Bacillus sonorensis strain SRCM101395]
ATGAAGAATACCGGAATTGTAAGAAGAATCGATGAGCTTGGCCGGGTGGTCCTGCCGGTGGAACTGAGAAGGGTGCTGAA
TATCAAGGAAAAAGATCCGCTTGAAATTTACAGCGACGGCGACAATATCATTCTTGCCAAATATGCAGCAAACATGGCCT
GTCTGATGACCGGTGAAATCACGACACAGAACAAAACGTACGCAGGCGGCAAAATCATCCTCAGCCCGCGCGGCGCCGAA
ATGCTTTTGGAAGATTTGCTGGAGGCCTTGTCCAACAGGAAATAA
ATGAAGAATACCGGAATTGTAAGAAGAATCGATGAGCTTGGCCGGGTGGTCCTGCCGGTGGAACTGAGAAGGGTGCTGAA
TATCAAGGAAAAAGATCCGCTTGAAATTTACAGCGACGGCGACAATATCATTCTTGCCAAATATGCAGCAAACATGGCCT
GTCTGATGACCGGTGAAATCACGACACAGAACAAAACGTACGCAGGCGGCAAAATCATCCTCAGCCCGCGCGGCGCCGAA
ATGCTTTTGGAAGATTTGCTGGAGGCCTTGTCCAACAGGAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.383 |
100 |
0.564 |