Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S100333_RS16440 Genome accession   NZ_CP021892
Coordinates   3081182..3081322 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SRCM100333     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3076182..3086322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100333_RS16415 (S100333_03352) yuxO 3076459..3076839 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  S100333_RS16420 (S100333_03353) comA 3076858..3077502 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  S100333_RS16425 (S100333_03354) comP 3077583..3079895 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  S100333_RS16430 (S100333_03355) comX 3079911..3080132 (-) 222 WP_014480704.1 competence pheromone ComX -
  S100333_RS16435 (S100333_03356) - 3080134..3080997 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  S100333_RS16440 (S100333_03357) degQ 3081182..3081322 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  S100333_RS22435 (S100333_03358) - 3081544..3081669 (+) 126 WP_003228793.1 hypothetical protein -
  S100333_RS16445 (S100333_03359) - 3081784..3082152 (+) 369 WP_046381300.1 hypothetical protein -
  S100333_RS16450 (S100333_03360) pdeH 3082128..3083357 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  S100333_RS16455 (S100333_03361) pncB 3083493..3084965 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  S100333_RS16460 (S100333_03362) pncA 3084981..3085532 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  S100333_RS16465 (S100333_03363) yueI 3085629..3086027 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=234557 S100333_RS16440 WP_003220708.1 3081182..3081322(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100333]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=234557 S100333_RS16440 WP_003220708.1 3081182..3081322(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100333]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment