Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S100761_RS16140 Genome accession   NZ_CP021889
Coordinates   3017129..3017269 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SRCM100761     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3012129..3022269
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100761_RS16115 (S100761_03211) yuxO 3012479..3012859 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  S100761_RS16120 (S100761_03212) comA 3012878..3013522 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  S100761_RS16125 (S100761_03213) comP 3013603..3015900 (-) 2298 WP_087614687.1 histidine kinase Regulator
  S100761_RS16130 (S100761_03214) comX 3015908..3016069 (-) 162 WP_003241045.1 competence pheromone ComX -
  S100761_RS16135 (S100761_03215) - 3016084..3016944 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  S100761_RS16140 (S100761_03216) degQ 3017129..3017269 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  S100761_RS21355 (S100761_03217) - 3017491..3017616 (+) 126 WP_003228793.1 hypothetical protein -
  S100761_RS16145 (S100761_03218) - 3017731..3018099 (+) 369 WP_046381300.1 hypothetical protein -
  S100761_RS16150 (S100761_03219) pdeH 3018075..3019304 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  S100761_RS16155 (S100761_03220) pncB 3019441..3020913 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  S100761_RS16160 (S100761_03221) pncA 3020929..3021480 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  S100761_RS16165 (S100761_03222) yueI 3021577..3021975 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=234480 S100761_RS16140 WP_003220708.1 3017129..3017269(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100761]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=234480 S100761_RS16140 WP_003220708.1 3017129..3017269(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100761]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment