Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   S100761_RS12695 Genome accession   NZ_CP021889
Coordinates   2368716..2368889 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain SRCM100761     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2363716..2373889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100761_RS12680 (S100761_02524) gcvT 2364515..2365603 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  S100761_RS12685 (S100761_02525) hepAA 2366045..2367718 (+) 1674 WP_014480248.1 SNF2-related protein -
  S100761_RS12690 (S100761_02526) yqhG 2367739..2368533 (+) 795 WP_014480249.1 YqhG family protein -
  S100761_RS12695 (S100761_02527) sinI 2368716..2368889 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S100761_RS12700 (S100761_02528) sinR 2368923..2369258 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S100761_RS12705 (S100761_02529) tasA 2369351..2370136 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  S100761_RS12710 (S100761_02530) sipW 2370200..2370772 (-) 573 WP_003230181.1 signal peptidase I SipW -
  S100761_RS12715 (S100761_02531) tapA 2370756..2371517 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  S100761_RS12720 (S100761_02532) yqzG 2371789..2372115 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  S100761_RS12725 (S100761_02533) spoIITA 2372157..2372336 (-) 180 WP_014480252.1 YqzE family protein -
  S100761_RS12730 (S100761_02534) comGG 2372407..2372781 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  S100761_RS12735 (S100761_02535) comGF 2372782..2373165 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  S100761_RS12740 (S100761_02536) comGE 2373191..2373538 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=234456 S100761_RS12695 WP_003230187.1 2368716..2368889(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100761]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=234456 S100761_RS12695 WP_003230187.1 2368716..2368889(+) (sinI) [Bacillus subtilis subsp. subtilis strain SRCM100761]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment