Detailed information NTG0232793

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: CCD89_RS13080
• Genome accession: NZ_CP021723
• Coordinates: 1846130..1846261 (-)
• Length: 43 a.a.
• NCBI ID: WP_306808038.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 13-600
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1841130..1851261

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CCD89_RS10365 (CCD89_10535)	-	1842439..1842723 (-)	285	WP_002216166.1	GIY-YIG nuclease family protein	-
CCD89_RS10370 (CCD89_10540)	pilC	1843098..1846160 (-)	3063	Protein_1768	PilC family type IV pilus tip adhesin	-
CCD89_RS13080	pilC	1846130..1846261 (-)	132	WP_306808038.1	hypothetical protein	Machinery gene
CCD89_RS10375 (CCD89_10550)	pilA	1846921..1848186 (-)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
CCD89_RS10380 (CCD89_10560)	msrAB	1848332..1849900 (+)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
CCD89_RS10385 (CCD89_10565)	-	1850002..1850487 (-)	486	WP_002221794.1	CinA family protein	-

Sequence

Protein

• Length: 43 a.a.
• Molecular weight: 5087.06 Da
• Isoelectric Point: 12.9102

>NTDB_id=232793 CCD89_RS13080 WP_306808038.1 1846130..1846261(-) (pilC) [Neisseria meningitidis strain 13-600]
MNKTWKRQVFRHTALYTAILMFSHTGGGGGRRKRKRKRINTLL

Nucleotide

• Length: 132 bp

>NTDB_id=232793 CCD89_RS13080 WP_306808038.1 1846130..1846261(-) (pilC) [Neisseria meningitidis strain 13-600]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	90	69.767	0.628