Detailed information    

insolico Bioinformatically predicted

Overview

Name   dinR/lexA   Type   Regulator
Locus tag   C1N79_RS26250 Genome accession   NZ_CP027297
Coordinates   5773465..5773686 (-) Length   73 a.a.
NCBI ID   WP_137961632.1    Uniprot ID   -
Organism   Streptomyces sp. SGAir0924     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context

Location: 5768465..5778686
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C1N79_RS26195 (C1N79_26210) - 5768622..5769203 (-) 582 WP_137961622.1 hypothetical protein -
  C1N79_RS36740 (C1N79_26215) - 5769200..5769772 (-) 573 WP_137961623.1 hypothetical protein -
  C1N79_RS26205 (C1N79_26220) - 5769769..5770056 (-) 288 WP_137961624.1 hypothetical protein -
  C1N79_RS36020 - 5770068..5770256 (-) 189 WP_175438089.1 hypothetical protein -
  C1N79_RS26215 (C1N79_26230) - 5770256..5771110 (-) 855 WP_137961625.1 protein transporter Sec31 -
  C1N79_RS26220 (C1N79_26235) - 5771182..5771367 (-) 186 WP_137961626.1 hypothetical protein -
  C1N79_RS26225 (C1N79_26240) - 5771442..5771633 (-) 192 WP_137961627.1 hypothetical protein -
  C1N79_RS36745 - 5771633..5771767 (-) 135 WP_019328824.1 hypothetical protein -
  C1N79_RS26230 (C1N79_26245) - 5771764..5772030 (-) 267 WP_137961628.1 hypothetical protein -
  C1N79_RS26235 (C1N79_26250) - 5772217..5772519 (+) 303 WP_175438090.1 helix-turn-helix domain-containing protein -
  C1N79_RS26240 (C1N79_26255) - 5772512..5772925 (+) 414 WP_137961630.1 DUF6221 family protein -
  C1N79_RS36220 - 5773088..5773249 (-) 162 WP_217623468.1 hypothetical protein -
  C1N79_RS26245 (C1N79_26260) - 5773271..5773468 (-) 198 WP_137961631.1 hypothetical protein -
  C1N79_RS26250 (C1N79_26265) dinR/lexA 5773465..5773686 (-) 222 WP_137961632.1 LexA family transcriptional regulator Regulator
  C1N79_RS26255 (C1N79_26270) - 5773733..5774071 (+) 339 WP_175438091.1 DUF6233 domain-containing protein -
  C1N79_RS26260 (C1N79_26275) - 5774158..5774409 (+) 252 WP_019328830.1 hypothetical protein -
  C1N79_RS26265 (C1N79_26280) - 5774538..5775164 (-) 627 WP_137961633.1 hypothetical protein -
  C1N79_RS26270 (C1N79_26285) - 5775273..5775719 (-) 447 WP_137961634.1 hypothetical protein -
  C1N79_RS26275 (C1N79_26290) - 5775765..5776520 (-) 756 WP_137961635.1 hypothetical protein -
  C1N79_RS26280 (C1N79_26295) - 5776622..5776825 (-) 204 WP_137961636.1 DNA-binding protein -
  C1N79_RS26285 (C1N79_26300) - 5776828..5777418 (-) 591 WP_137961637.1 hypothetical protein -
  C1N79_RS36025 - 5777415..5777585 (-) 171 WP_175438092.1 hypothetical protein -
  C1N79_RS26290 (C1N79_26305) - 5777582..5777839 (-) 258 WP_137961638.1 hypothetical protein -
  C1N79_RS26295 (C1N79_26310) - 5777836..5778021 (-) 186 WP_019328841.1 hypothetical protein -
  C1N79_RS26300 (C1N79_26315) - 5778131..5778370 (-) 240 WP_137961639.1 hypothetical protein -

Sequence

Protein


Download         Length: 73 a.a.        Molecular weight: 8212.39 Da        Isoelectric Point: 8.6793

>NTDB_id=231689 C1N79_RS26250 WP_137961632.1 5773465..5773686(-) (dinR/lexA) [Streptomyces sp. SGAir0924]
MAQHRVEYLTPRQEEILRVIRLAITDQGDAPTVAEIAEQVGLRPSSVHYQLRELETKGAIHRQPGTARGIRLA

Nucleotide


Download         Length: 222 bp        

>NTDB_id=231689 C1N79_RS26250 WP_137961632.1 5773465..5773686(-) (dinR/lexA) [Streptomyces sp. SGAir0924]
ATGGCCCAGCACCGCGTCGAATACCTCACCCCACGACAGGAAGAGATCCTCCGCGTCATCCGCCTGGCCATCACCGACCA
GGGCGACGCCCCCACCGTCGCCGAGATCGCCGAGCAGGTCGGGCTCCGGCCGTCCTCGGTCCACTACCAGCTGCGCGAGC
TGGAGACGAAAGGCGCCATCCACCGGCAGCCCGGCACCGCGCGCGGAATCCGGCTCGCATGA

Domains

Predicted by InterProScan.

LexA DNA binding domain (LexA_DNA_bind)

(8-69)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

47.692

89.041

0.425

Multiple sequence alignment