Detailed information NTG0231568

Bioinformatically predicted

Overview

• Name: pilC
• Type: Machinery gene
• Locus tag: CCD90_RS13020
• Genome accession: NZ_CP021516
• Coordinates: 1845620..1845748 (-)
• Length: 42 a.a.
• NCBI ID: WP_308439710.1
• Uniprot ID: -
• Organism: Neisseria meningitidis strain 14-563
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1840620..1850748

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CCD90_RS10360 (CCD90_10545)	-	1841929..1842213 (-)	285	WP_002216166.1	GIY-YIG nuclease family protein	-
CCD90_RS10365 (CCD90_10550)	pilC	1842588..1845647 (-)	3060	Protein_1768	PilC family type IV pilus tip adhesin	-
CCD90_RS13020	pilC	1845620..1845748 (-)	129	WP_308439710.1	hypothetical protein	Machinery gene
CCD90_RS10370 (CCD90_10560)	pilA	1846408..1847673 (-)	1266	WP_002228837.1	signal recognition particle-docking protein FtsY	Machinery gene
CCD90_RS10375 (CCD90_10570)	msrAB	1847819..1849387 (+)	1569	WP_002216163.1	bifunctional peptide-methionine (S)-S-oxide reductase MsrA/peptide-methionine (R)-S-oxide reductase MsrB	-
CCD90_RS10380 (CCD90_10575)	-	1849489..1849974 (-)	486	WP_002221794.1	CinA family protein	-

Sequence

Protein

• Length: 42 a.a.
• Molecular weight: 5030.00 Da
• Isoelectric Point: 12.9102

>NTDB_id=231568 CCD90_RS13020 WP_308439710.1 1845620..1845748(-) (pilC) [Neisseria meningitidis strain 14-563]
MNKTWKRQVFRHTALYTAILMFSHTGGGGRRKRKRKRINTLL

Nucleotide

• Length: 129 bp

>NTDB_id=231568 CCD90_RS13020 WP_308439710.1 1845620..1845748(-) (pilC) [Neisseria meningitidis strain 14-563]
ATGAATAAAACTTGGAAACGGCAGGTTTTCCGCCATACCGCGCTTTATACCGCCATATTGATGTTTTCCCATACCGGCGG
GGGGGGCAGGCGCAAGCGCAAACGCAAACGCATAAATACGCTATTGTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilC	Neisseria meningitidis A1493	77.778	85.714	0.667