Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   S101441_RS16700 Genome accession   NZ_CP021507
Coordinates   3132447..3132587 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SRCM101441     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3127447..3137587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101441_RS16675 (S101441_03357) yuxO 3127724..3128104 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  S101441_RS16680 (S101441_03358) comA 3128123..3128767 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  S101441_RS16685 (S101441_03359) comP 3128848..3131160 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  S101441_RS16690 (S101441_03360) comX 3131176..3131397 (-) 222 WP_014480704.1 competence pheromone ComX -
  S101441_RS16695 (S101441_03361) - 3131399..3132262 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  S101441_RS16700 (S101441_03362) degQ 3132447..3132587 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  S101441_RS22545 (S101441_03363) - 3132809..3132934 (+) 126 WP_003228793.1 hypothetical protein -
  S101441_RS16705 (S101441_03364) - 3133049..3133417 (+) 369 WP_046381300.1 hypothetical protein -
  S101441_RS16710 (S101441_03365) pdeH 3133393..3134622 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  S101441_RS16715 (S101441_03366) pncB 3134758..3136230 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  S101441_RS16720 (S101441_03367) pncA 3136246..3136797 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  S101441_RS16725 (S101441_03368) yueI 3136894..3137292 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=231497 S101441_RS16700 WP_003220708.1 3132447..3132587(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM101441]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=231497 S101441_RS16700 WP_003220708.1 3132447..3132587(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM101441]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment