Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S101267_RS16395 Genome accession   NZ_CP021505
Coordinates   3135460..3135600 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain SRCM101267     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3130460..3140600
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101267_RS16370 (S101267_03297) - 3130779..3131162 (-) 384 WP_013353393.1 hotdog fold thioesterase -
  S101267_RS16375 (S101267_03298) comA 3131184..3131828 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  S101267_RS16380 (S101267_03299) comP 3131909..3134215 (-) 2307 WP_013353395.1 sensor histidine kinase Regulator
  S101267_RS16385 (S101267_03300) comX 3134238..3134414 (-) 177 WP_013353396.1 competence pheromone ComX -
  S101267_RS16390 (S101267_03301) - 3134433..3135308 (-) 876 WP_013353397.1 polyprenyl synthetase family protein -
  S101267_RS16395 (S101267_03302) degQ 3135460..3135600 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  S101267_RS16405 (S101267_03303) - 3136065..3136406 (+) 342 WP_013353399.1 hypothetical protein -
  S101267_RS16410 (S101267_03304) - 3136413..3137636 (-) 1224 WP_013353400.1 EAL and HDOD domain-containing protein -
  S101267_RS16415 (S101267_03305) - 3137766..3139232 (-) 1467 WP_088030648.1 nicotinate phosphoribosyltransferase -
  S101267_RS16420 (S101267_03306) - 3139250..3139801 (-) 552 WP_013353402.1 cysteine hydrolase family protein -
  S101267_RS16425 (S101267_03307) - 3139882..3140277 (-) 396 WP_013353403.1 YueI family protein -
  S101267_RS16430 (S101267_03308) - 3140343..3140591 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=231420 S101267_RS16395 WP_013353398.1 3135460..3135600(-) (degQ) [Bacillus amyloliquefaciens strain SRCM101267]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=231420 S101267_RS16395 WP_013353398.1 3135460..3135600(-) (degQ) [Bacillus amyloliquefaciens strain SRCM101267]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment