Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   S100757_RS16140 Genome accession   NZ_CP021499
Coordinates   3017142..3017282 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain SRCM100757     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3012142..3022282
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100757_RS16115 (S100757_03200) yuxO 3012492..3012872 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  S100757_RS16120 (S100757_03201) comA 3012891..3013535 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  S100757_RS16125 (S100757_03202) comP 3013616..3015913 (-) 2298 WP_087614687.1 histidine kinase Regulator
  S100757_RS16130 (S100757_03203) comX 3015921..3016082 (-) 162 WP_003241045.1 competence pheromone ComX -
  S100757_RS16135 (S100757_03204) - 3016097..3016957 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  S100757_RS16140 (S100757_03205) degQ 3017142..3017282 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  S100757_RS21345 (S100757_03206) - 3017504..3017629 (+) 126 WP_003228793.1 hypothetical protein -
  S100757_RS16145 (S100757_03207) - 3017744..3018112 (+) 369 WP_046381300.1 hypothetical protein -
  S100757_RS16150 (S100757_03208) pdeH 3018088..3019317 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  S100757_RS16155 (S100757_03209) pncB 3019454..3020926 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  S100757_RS16160 (S100757_03210) pncA 3020942..3021493 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  S100757_RS16165 (S100757_03211) yueI 3021590..3021988 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=231237 S100757_RS16140 WP_003220708.1 3017142..3017282(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100757]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=231237 S100757_RS16140 WP_003220708.1 3017142..3017282(-) (degQ) [Bacillus subtilis subsp. subtilis strain SRCM100757]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment