Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   S100757_RS12730 Genome accession   NZ_CP021499
Coordinates   2372419..2372793 (-) Length   124 a.a.
NCBI ID   WP_015714252.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain SRCM100757     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2367419..2377793
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S100757_RS12690 (S100757_02516) yqhG 2367751..2368545 (+) 795 WP_014480249.1 YqhG family protein -
  S100757_RS12695 (S100757_02517) sinI 2368728..2368901 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  S100757_RS12700 (S100757_02518) sinR 2368935..2369270 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  S100757_RS12705 (S100757_02519) tasA 2369363..2370148 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  S100757_RS12710 (S100757_02520) sipW 2370212..2370784 (-) 573 WP_003230181.1 signal peptidase I SipW -
  S100757_RS12715 (S100757_02521) tapA 2370768..2371529 (-) 762 WP_087614619.1 amyloid fiber anchoring/assembly protein TapA -
  S100757_RS12720 (S100757_02522) yqzG 2371801..2372127 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  S100757_RS12725 (S100757_02523) spoIITA 2372169..2372348 (-) 180 WP_014480252.1 YqzE family protein -
  S100757_RS12730 (S100757_02524) comGG 2372419..2372793 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  S100757_RS12735 (S100757_02525) comGF 2372794..2373177 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  S100757_RS12740 (S100757_02526) comGE 2373203..2373550 (-) 348 WP_087614620.1 ComG operon protein 5 Machinery gene
  S100757_RS12745 (S100757_02527) comGD 2373534..2373965 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  S100757_RS12750 (S100757_02528) comGC 2373955..2374251 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  S100757_RS12755 (S100757_02529) comGB 2374265..2375302 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  S100757_RS12760 (S100757_02530) comGA 2375289..2376359 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  S100757_RS12765 (S100757_02531) - 2376571..2376768 (-) 198 WP_014480259.1 CBS domain-containing protein -
  S100757_RS12770 (S100757_02532) corA 2376770..2377723 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14524.73 Da        Isoelectric Point: 8.7849

>NTDB_id=231215 S100757_RS12730 WP_015714252.1 2372419..2372793(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM100757]
MYRTRGFIYPAILFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=231215 S100757_RS12730 WP_015714252.1 2372419..2372793(-) (comGG) [Bacillus subtilis subsp. subtilis strain SRCM100757]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCAATTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGGACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.968

100

0.96


Multiple sequence alignment