Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   S101444_RS06385 Genome accession   NZ_CP021498
Coordinates   1222040..1222231 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain SRCM101444     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1217040..1227231
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S101444_RS06355 (S101444_01251) argF 1217903..1218862 (+) 960 WP_046160277.1 ornithine carbamoyltransferase -
  S101444_RS06360 (S101444_01252) yjzC 1218948..1219127 (+) 180 WP_003245356.1 YjzC family protein -
  S101444_RS06365 (S101444_01253) yjzD 1219174..1219359 (-) 186 WP_003245236.1 DUF2929 domain-containing protein -
  S101444_RS06370 (S101444_01254) - 1219608..1220342 (+) 735 WP_003245223.1 hypothetical protein -
  S101444_RS06375 (S101444_01255) - 1220424..1220981 (+) 558 WP_046160278.1 hypothetical protein -
  S101444_RS06380 (S101444_01256) med 1221072..1222025 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  S101444_RS06385 (S101444_01257) comZ 1222040..1222231 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  S101444_RS06390 (S101444_01258) yjzB 1222261..1222497 (-) 237 WP_072173825.1 spore coat protein YjzB -
  S101444_RS06395 (S101444_01259) fabH 1222662..1223600 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  S101444_RS06400 (S101444_01260) fabF 1223622..1224863 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  S101444_RS06405 (S101444_01261) yjaZ 1224939..1225724 (+) 786 WP_021479557.1 DUF2268 domain-containing protein -
  S101444_RS06410 (S101444_01262) appD 1225916..1226902 (+) 987 WP_046160279.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=231116 S101444_RS06385 WP_003224559.1 1222040..1222231(+) (comZ) [Bacillus subtilis subsp. subtilis strain SRCM101444]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=231116 S101444_RS06385 WP_003224559.1 1222040..1222231(+) (comZ) [Bacillus subtilis subsp. subtilis strain SRCM101444]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGATGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment