Detailed information    

insolico Bioinformatically predicted

Overview


Name   sxy/tfoX   Type   Regulator
Locus tag   EC95NR1_RS05520 Genome accession   NZ_CP021339
Coordinates   1099931..1100515 (+) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain 95NR1     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1083676..1121093 1099931..1100515 within 0


Gene organization within MGE regions


Location: 1083676..1121093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EC95NR1_RS05450 (EC95NR1_05223) zapC 1084700..1085242 (+) 543 WP_001295353.1 cell division protein ZapC -
  EC95NR1_RS05455 (EC95NR1_05224) ycbX 1085239..1086348 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  EC95NR1_RS05460 (EC95NR1_05225) rlmKL 1086592..1088700 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  EC95NR1_RS05465 (EC95NR1_05226) uup 1088712..1090619 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  EC95NR1_RS05470 (EC95NR1_05227) pqiA 1090749..1092002 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  EC95NR1_RS05475 (EC95NR1_05228) pqiB 1092007..1093647 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  EC95NR1_RS05480 (EC95NR1_05229) pqiC 1093644..1094207 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  EC95NR1_RS05485 (EC95NR1_05230) rmf 1094463..1094630 (+) 168 WP_000828648.1 ribosome modulation factor -
  EC95NR1_RS05490 (EC95NR1_05231) fabA 1094700..1095218 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  EC95NR1_RS05495 (EC95NR1_05232) ycbZ 1095287..1097047 (-) 1761 WP_000156528.1 Lon protease family protein -
  EC95NR1_RS05500 (EC95NR1_05233) matP 1097233..1097685 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  EC95NR1_RS05505 (EC95NR1_05234) ompA 1097761..1098801 (-) 1041 WP_000750416.1 porin OmpA -
  EC95NR1_RS05515 (EC95NR1_05235) sulA 1099158..1099667 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  EC95NR1_RS05520 (EC95NR1_05236) sxy/tfoX 1099931..1100515 (+) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  EC95NR1_RS05525 (EC95NR1_05237) yccS 1100478..1102640 (-) 2163 WP_000875023.1 YccS family putative transporter -
  EC95NR1_RS05530 (EC95NR1_05238) yccF 1102650..1103096 (-) 447 WP_001261235.1 YccF domain-containing protein -
  EC95NR1_RS05535 (EC95NR1_05239) helD 1103219..1105273 (+) 2055 WP_001297106.1 DNA helicase IV -
  EC95NR1_RS05540 (EC95NR1_05240) mgsA 1105305..1105763 (-) 459 WP_000424181.1 methylglyoxal synthase -
  EC95NR1_RS05545 (EC95NR1_05241) yccT 1105859..1106521 (-) 663 WP_000847791.1 DUF2057 family protein -
  EC95NR1_RS05550 (EC95NR1_05242) yccU 1106694..1107107 (+) 414 WP_000665217.1 CoA-binding protein -
  EC95NR1_RS05555 (EC95NR1_05243) hspQ 1107152..1107469 (-) 318 WP_001295356.1 heat shock protein HspQ -
  EC95NR1_RS05560 (EC95NR1_05244) rlmI 1107527..1108717 (-) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  EC95NR1_RS05565 (EC95NR1_05245) yccX 1108812..1109090 (+) 279 WP_000048244.1 acylphosphatase -
  EC95NR1_RS05570 (EC95NR1_05246) tusE 1109087..1109416 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  EC95NR1_RS05575 (EC95NR1_05247) yccA 1109507..1110166 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  EC95NR1_RS05580 (EC95NR1_05248) - 1110574..1111589 (-) 1016 Protein_1032 tyrosine-type recombinase/integrase -
  EC95NR1_RS30505 (EC95NR1_05250) - 1111567..1111809 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  EC95NR1_RS05585 (EC95NR1_05251) - 1111877..1114348 (-) 2472 WP_086893271.1 exonuclease -
  EC95NR1_RS05590 (EC95NR1_05252) - 1114441..1114632 (-) 192 WP_001090200.1 DUF1482 family protein -
  EC95NR1_RS05595 (EC95NR1_05253) dicB 1114629..1114817 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  EC95NR1_RS05605 (EC95NR1_05256) - 1115349..1115723 (-) 375 WP_000394557.1 hypothetical protein -
  EC95NR1_RS05610 (EC95NR1_05257) - 1115735..1115887 (-) 153 WP_000379580.1 DUF1391 family protein -
  EC95NR1_RS05620 (EC95NR1_05258) - 1116160..1116876 (-) 717 WP_000103686.1 S24 family peptidase -
  EC95NR1_RS05625 (EC95NR1_05259) - 1116926..1117141 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  EC95NR1_RS05630 (EC95NR1_05260) - 1117138..1117563 (+) 426 WP_000693949.1 toxin YdaT family protein -
  EC95NR1_RS05635 (EC95NR1_05261) - 1117635..1118705 (+) 1071 WP_001262389.1 hypothetical protein -
  EC95NR1_RS05640 (EC95NR1_05262) - 1118746..1119168 (+) 423 WP_001151153.1 DUF977 family protein -
  EC95NR1_RS05645 (EC95NR1_05263) - 1119165..1119461 (+) 297 WP_001266135.1 DUF4406 domain-containing protein -
  EC95NR1_RS05650 (EC95NR1_05264) - 1119458..1119919 (+) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  EC95NR1_RS05655 (EC95NR1_05265) - 1119897..1120253 (+) 357 WP_000403777.1 hypothetical protein -
  EC95NR1_RS05660 (EC95NR1_05266) - 1120304..1120516 (+) 213 WP_000935420.1 hypothetical protein -
  EC95NR1_RS05665 - 1120549..1120766 (+) 218 Protein_1048 DUF4014 family protein -
  EC95NR1_RS05670 (EC95NR1_05267) - 1120768..1121031 (+) 264 WP_000224233.1 hypothetical protein -

Sequence


Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=230008 EC95NR1_RS05520 WP_077825616.1 1099931..1100515(+) (sxy/tfoX) [Escherichia coli strain 95NR1]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=230008 EC95NR1_RS05520 WP_077825616.1 1099931..1100515(+) (sxy/tfoX) [Escherichia coli strain 95NR1]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995


Multiple sequence alignment