Detailed information    

insolico Bioinformatically predicted

Overview

Name   ceuB   Type   Machinery gene
Locus tag   CDIF101085_RS07960 Genome accession   NZ_CP021319
Coordinates   1684842..1685669 (+) Length   275 a.a.
NCBI ID   WP_330367607.1    Uniprot ID   -
Organism   Clostridioides difficile strain DSM 101085     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1652839..1714366 1684842..1685669 within 0


Gene organization within MGE regions


Location: 1652839..1714366
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CDIF101085_RS07830 (CDIF101085_01608) - 1653503..1655047 (+) 1545 WP_022616005.1 putative bifunctional diguanylate cyclase/phosphodiesterase -
  CDIF101085_RS07835 (CDIF101085_01609) - 1655223..1655591 (+) 369 WP_003420238.1 GntR family transcriptional regulator -
  CDIF101085_RS07840 (CDIF101085_01610) - 1655593..1656318 (+) 726 WP_003420240.1 ABC transporter ATP-binding protein -
  CDIF101085_RS07845 (CDIF101085_01611) - 1656312..1657076 (+) 765 WP_022616006.1 hypothetical protein -
  CDIF101085_RS07850 (CDIF101085_01612) - 1657322..1658572 (+) 1251 WP_003420244.1 MFS transporter -
  CDIF101085_RS07855 (CDIF101085_01613) - 1658764..1659648 (+) 885 WP_003420246.1 mechanosensitive ion channel family protein -
  CDIF101085_RS07860 (CDIF101085_01614) - 1660007..1660624 (+) 618 WP_003420248.1 PepSY domain-containing protein -
  CDIF101085_RS07865 (CDIF101085_01615) - 1660730..1663261 (+) 2532 WP_022616007.1 FAD-dependent oxidoreductase -
  CDIF101085_RS07870 (CDIF101085_01616) - 1663472..1664092 (+) 621 WP_003420252.1 TVP38/TMEM64 family protein -
  CDIF101085_RS07875 (CDIF101085_01617) - 1664259..1664795 (-) 537 WP_009905530.1 metal-dependent hydrolase -
  CDIF101085_RS07880 (CDIF101085_01618) - 1664908..1665612 (-) 705 WP_003420256.1 superoxide dismutase -
  CDIF101085_RS07885 (CDIF101085_01619) asnB 1665785..1667668 (+) 1884 WP_003420258.1 asparagine synthase (glutamine-hydrolyzing) -
  CDIF101085_RS07890 (CDIF101085_01620) - 1667759..1669195 (-) 1437 WP_003420260.1 trypsin-like peptidase domain-containing protein -
  CDIF101085_RS07895 (CDIF101085_01621) - 1669524..1670102 (+) 579 WP_003420269.1 TerD family protein -
  CDIF101085_RS07900 (CDIF101085_01622) - 1670141..1670719 (+) 579 WP_003420272.1 TerD family protein -
  CDIF101085_RS07905 (CDIF101085_01623) - 1670805..1671434 (+) 630 WP_022616008.1 TerD family protein -
  CDIF101085_RS07910 (CDIF101085_01624) - 1671424..1674183 (+) 2760 WP_003420276.1 calcium-translocating P-type ATPase, PMCA-type -
  CDIF101085_RS07915 (CDIF101085_01625) - 1674270..1675832 (+) 1563 WP_022616009.1 YceG family protein -
  CDIF101085_RS07920 (CDIF101085_01626) - 1675833..1676969 (+) 1137 WP_003420279.1 toxic anion resistance protein -
  CDIF101085_RS07925 (CDIF101085_01627) - 1677031..1678107 (+) 1077 WP_003420280.1 HpcH/HpaI aldolase/citrate lyase family protein -
  CDIF101085_RS07930 (CDIF101085_01628) - 1678085..1679323 (+) 1239 WP_003420284.1 phosphoribosyltransferase family protein -
  CDIF101085_RS07935 (CDIF101085_01629) - 1679377..1680465 (+) 1089 WP_003420286.1 cysteine protease StiP family protein -
  CDIF101085_RS07940 (CDIF101085_01630) - 1680493..1681284 (+) 792 WP_003420287.1 HAD family hydrolase -
  CDIF101085_RS07945 (CDIF101085_01631) - 1681399..1681953 (-) 555 WP_003420290.1 cupin domain-containing protein -
  CDIF101085_RS07950 (CDIF101085_01632) - 1682147..1683349 (+) 1203 WP_009905536.1 DUF819 domain-containing protein -
  CDIF101085_RS07955 (CDIF101085_01633) - 1683406..1684386 (+) 981 WP_003420295.1 dipeptidase -
  CDIF101085_RS19600 - 1684648..1684842 (+) 195 WP_330367606.1 hypothetical protein -
  CDIF101085_RS07960 (CDIF101085_01634) ceuB 1684842..1685669 (+) 828 WP_330367607.1 ABC transporter permease Machinery gene
  CDIF101085_RS07965 (CDIF101085_01636) - 1685659..1686615 (+) 957 WP_003420299.1 iron chelate uptake ABC transporter family permease subunit -
  CDIF101085_RS07970 (CDIF101085_01637) - 1686612..1687367 (+) 756 WP_003420301.1 ABC transporter ATP-binding protein -
  CDIF101085_RS07975 (CDIF101085_01638) - 1687598..1688788 (-) 1191 WP_022615823.1 tyrosine-type recombinase/integrase -
  CDIF101085_RS07980 (CDIF101085_01639) - 1688867..1689070 (-) 204 WP_002347229.1 excisionase -
  CDIF101085_RS07985 (CDIF101085_01640) - 1689441..1689689 (-) 249 WP_022615824.1 helix-turn-helix domain-containing protein -
  CDIF101085_RS07990 (CDIF101085_01641) - 1689691..1690110 (-) 420 WP_005428626.1 RNA polymerase sigma factor -
  CDIF101085_RS07995 (CDIF101085_01642) - 1690386..1690610 (-) 225 WP_022615825.1 hypothetical protein -
  CDIF101085_RS08000 (CDIF101085_01643) - 1690623..1691231 (-) 609 WP_022615826.1 ABC-2 transporter permease -
  CDIF101085_RS08005 (CDIF101085_01644) - 1691233..1692087 (-) 855 WP_032553584.1 ABC transporter ATP-binding protein -
  CDIF101085_RS08010 (CDIF101085_01645) - 1692092..1692466 (-) 375 WP_022615829.1 GntR family transcriptional regulator -
  CDIF101085_RS08015 (CDIF101085_01646) - 1692589..1693500 (-) 912 WP_022615830.1 conjugal transfer protein -
  CDIF101085_RS08020 (CDIF101085_01647) - 1693516..1694523 (-) 1008 WP_022615831.1 lysozyme family protein -
  CDIF101085_RS08025 (CDIF101085_01648) - 1694520..1696730 (-) 2211 WP_022615832.1 CD3337/EF1877 family mobilome membrane protein -
  CDIF101085_RS08030 (CDIF101085_01649) - 1696730..1699180 (-) 2451 WP_022615836.1 ATP-binding protein -
  CDIF101085_RS08035 (CDIF101085_01650) - 1699158..1699556 (-) 399 WP_004843362.1 conjugal transfer protein -
  CDIF101085_RS08040 (CDIF101085_01651) - 1699675..1700178 (-) 504 WP_008977178.1 antirestriction protein ArdA -
  CDIF101085_RS08045 (CDIF101085_01652) - 1700196..1700699 (-) 504 WP_009898624.1 antirestriction protein ArdA -
  CDIF101085_RS08050 - 1700618..1700914 (-) 297 WP_022615838.1 hypothetical protein -
  CDIF101085_RS08055 (CDIF101085_01653) - 1701003..1701644 (-) 642 WP_032553591.1 alpha/beta hydrolase -
  CDIF101085_RS08060 (CDIF101085_01654) - 1701679..1701900 (-) 222 WP_002323342.1 hypothetical protein -
  CDIF101085_RS08065 (CDIF101085_01655) - 1701902..1702036 (-) 135 WP_022615839.1 DUF3789 domain-containing protein -
  CDIF101085_RS08070 (CDIF101085_01656) mobT 1702049..1703245 (-) 1197 WP_022615840.1 MobT family relaxase -
  CDIF101085_RS08075 (CDIF101085_01657) - 1703429..1704823 (-) 1395 WP_022615842.1 FtsK/SpoIIIE domain-containing protein -
  CDIF101085_RS08080 (CDIF101085_01658) - 1704924..1705085 (-) 162 WP_022615845.1 DUF6440 family protein -
  CDIF101085_RS08085 (CDIF101085_01659) - 1705183..1705566 (-) 384 WP_002347267.1 YdcP family protein -
  CDIF101085_RS08090 (CDIF101085_01660) - 1705582..1705908 (-) 327 WP_005428604.1 YdcP family protein -
  CDIF101085_RS08095 (CDIF101085_01661) - 1706143..1709187 (-) 3045 WP_032553595.1 SrtB-anchored collagen-binding adhesin -
  CDIF101085_RS08100 (CDIF101085_01662) - 1709515..1710480 (+) 966 WP_003420303.1 siderophore ABC transporter substrate-binding protein -
  CDIF101085_RS08105 (CDIF101085_01663) - 1710934..1712793 (+) 1860 WP_022616010.1 putative bifunctional diguanylate cyclase/phosphodiesterase -
  CDIF101085_RS08110 (CDIF101085_01664) - 1712993..1713592 (-) 600 WP_003420307.1 TerD family protein -

Sequence

Protein


Download         Length: 275 a.a.        Molecular weight: 30135.47 Da        Isoelectric Point: 9.5616

>NTDB_id=229765 CDIF101085_RS07960 WP_330367607.1 1684842..1685669(+) (ceuB) [Clostridioides difficile strain DSM 101085]
MSRVPRLISILIAGVGMSIAGLIMQQISKNKFVSPTTGATIDAAQFGIVICMLLVPTASIFTKTIIAFVFSLVGTFMFMK
IIGKLQFKNIIFVPLVGIMFGNIIGSMTDFIAYKYDLSQNVSSWMQGDFSMILKGNYEILYITIPLIILAYIYANKFTVV
GMGMDFATNLGLSYKRIVNIGLIIVALVTVCVVVTAGNIPFIGLIVPNIVSLYMGDNIRASIWYTGLLGAIFVLICDIFG
RIIIYPYEISIGLTVGVIGSILFLYLILRRNVNEA

Nucleotide


Download         Length: 828 bp        

>NTDB_id=229765 CDIF101085_RS07960 WP_330367607.1 1684842..1685669(+) (ceuB) [Clostridioides difficile strain DSM 101085]
ATGAGTAGAGTACCAAGATTAATAAGTATATTGATTGCTGGTGTAGGAATGAGCATAGCAGGTCTTATAATGCAACAGAT
AAGTAAAAATAAATTTGTATCACCTACAACAGGAGCTACAATAGACGCAGCTCAATTTGGGATAGTGATATGTATGCTTT
TAGTACCAACTGCCTCTATTTTTACAAAGACAATAATAGCATTTGTATTTTCTCTTGTAGGGACTTTTATGTTTATGAAA
ATAATAGGTAAGTTACAATTTAAAAATATAATCTTTGTACCATTAGTAGGTATAATGTTTGGAAATATAATAGGTTCTAT
GACAGATTTTATAGCATATAAATACGATTTGAGTCAAAATGTTAGCTCTTGGATGCAGGGTGACTTTTCTATGATACTTA
AAGGAAATTATGAGATATTATATATAACAATACCCCTTATAATACTAGCATATATTTATGCAAACAAATTTACTGTTGTT
GGTATGGGTATGGATTTTGCAACAAACTTAGGTCTTAGTTACAAAAGAATTGTCAATATAGGTCTGATAATAGTAGCACT
TGTTACAGTATGTGTAGTTGTTACAGCTGGTAATATACCTTTTATAGGTCTAATAGTTCCAAATATCGTATCCTTATATA
TGGGCGATAATATAAGAGCAAGTATATGGTATACAGGTTTACTTGGAGCTATATTTGTACTTATATGTGATATTTTTGGA
AGAATTATTATTTATCCATATGAAATATCTATAGGACTTACAGTTGGAGTTATAGGAAGTATACTATTCCTTTATTTAAT
ATTAAGGAGGAATGTAAATGAAGCTTAG

Domains

Predicted by InterproScan.

FecCD transport family (FecCD)

(2-269)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ceuB Campylobacter jejuni subsp. jejuni 81-176

51.661

98.545

0.509

Multiple sequence alignment