Detailed information    

insolico Bioinformatically predicted

Overview

Name   rocC   Type   Regulator
Locus tag   CA924_RS00770 Genome accession   NZ_CP021281
Coordinates   165048..165740 (+) Length   230 a.a.
NCBI ID   WP_011212783.1    Uniprot ID   -
Organism   Legionella pneumophila subsp. pneumophila strain Flint     
Function   rocR chaperone; repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 148431..219390 165048..165740 within 0


Gene organization within MGE regions


Location: 148431..219390
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CA924_RS00710 - 149369..150667 (+) 1299 WP_010945883.1 nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein -
  CA924_RS00715 - 150828..151442 (-) 615 WP_011212772.1 thiol:disulfide interchange protein DsbA/DsbL -
  CA924_RS00720 - 151453..152055 (-) 603 WP_011212773.1 c-type cytochrome -
  CA924_RS00725 yihA 152130..152732 (+) 603 WP_011212774.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  CA924_RS00730 cegC2 152846..156157 (+) 3312 WP_011212775.1 Dot/Icm T4SS effector CegC2 -
  CA924_RS00735 acs 156254..158137 (-) 1884 WP_025519195.1 acetate--CoA ligase -
  CA924_RS00740 mmsB 158139..159035 (-) 897 WP_011212777.1 3-hydroxyisobutyrate dehydrogenase -
  CA924_RS00745 - 159059..160558 (-) 1500 WP_011212778.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -
  CA924_RS00750 - 160669..160845 (-) 177 WP_011212779.1 dodecin domain-containing protein -
  CA924_RS00755 - 161023..163491 (+) 2469 WP_011212780.1 hypothetical protein -
  CA924_RS00760 dapB 163595..164326 (-) 732 WP_011212781.1 4-hydroxy-tetrahydrodipicolinate reductase -
  CA924_RS00765 - 164506..164691 (-) 186 WP_011212782.1 hypothetical protein -
  CA924_RS00770 rocC 165048..165740 (+) 693 WP_011212783.1 ProQ/FinO family protein Regulator
  CA924_RS00775 - 165741..166811 (+) 1071 WP_011212784.1 hypothetical protein -
  CA924_RS00780 - 166911..172538 (-) 5628 WP_011212785.1 hypothetical protein -
  CA924_RS00785 pyk 172630..174054 (-) 1425 WP_011212786.1 pyruvate kinase -
  CA924_RS00790 - 174038..175228 (-) 1191 WP_011212787.1 phosphoglycerate kinase -
  CA924_RS00795 gap 175239..176231 (-) 993 WP_011212788.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  CA924_RS00800 tkt 176312..178390 (-) 2079 WP_080019868.1 transketolase -
  CA924_RS00805 - 178576..179910 (+) 1335 WP_011212790.1 hypothetical protein -
  CA924_RS00810 - 180010..182025 (+) 2016 WP_025519199.1 M3 family metallopeptidase -
  CA924_RS00820 - 182832..183152 (+) 321 WP_126297580.1 hypothetical protein -
  CA924_RS00830 cas9 183628..187746 (+) 4119 WP_011212792.1 type II-B CRISPR-associated RNA-guided endonuclease Cas9/Csx12 -
  CA924_RS00835 cas1 187743..188735 (+) 993 WP_011212793.1 CRISPR-associated endonuclease Cas1 -
  CA924_RS00840 cas2 188742..189041 (+) 300 WP_011212794.1 CRISPR-associated endonuclease Cas2 -
  CA924_RS00845 cas4 189022..189615 (+) 594 WP_011212795.1 CRISPR-associated protein Cas4 -
  CA924_RS00850 - 193160..193597 (+) 438 WP_021437110.1 YgjP-like metallopeptidase domain-containing protein -
  CA924_RS00855 - 193587..194261 (-) 675 WP_025519205.1 S24 family peptidase -
  CA924_RS17150 - 194423..195292 (+) 870 WP_011212797.1 hypothetical protein -
  CA924_RS00865 - 195258..195620 (+) 363 WP_021437111.1 hypothetical protein -
  CA924_RS00870 - 195633..195836 (+) 204 WP_011212799.1 carbon storage regulator -
  CA924_RS00875 - 195833..196135 (+) 303 WP_011212800.1 TrbC/VirB2 family protein -
  CA924_RS00880 - 196145..196426 (+) 282 WP_011212801.1 VirB3 family type IV secretion system protein -
  CA924_RS00885 - 196413..198893 (+) 2481 WP_011212802.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  CA924_RS00890 - 198890..199600 (+) 711 WP_011212803.1 type IV secretion system protein -
  CA924_RS00895 lvhB7 199615..199761 (+) 147 WP_011212804.1 T4SS-associated protein LvhB7 -
  CA924_RS00900 lvrD 199758..200153 (+) 396 WP_011212805.1 T4SS-associated protein LvrD -
  CA924_RS00905 - 200157..201197 (+) 1041 WP_011212806.1 type IV secretion system protein -
  CA924_RS00910 - 201194..201910 (+) 717 WP_011212807.1 type IV secretion system protein -
  CA924_RS00915 virB9 201907..202659 (+) 753 WP_011212808.1 P-type conjugative transfer protein VirB9 -
  CA924_RS00920 - 202656..203747 (+) 1092 WP_011212809.1 TrbI/VirB10 family protein -
  CA924_RS00925 virB11 203749..204753 (+) 1005 WP_011212810.1 P-type DNA transfer ATPase VirB11 -
  CA924_RS00930 - 204746..206647 (+) 1902 WP_011212811.1 type IV secretory system conjugative DNA transfer family protein -
  CA924_RS00935 - 206745..207542 (+) 798 WP_011212812.1 DUF1566 domain-containing protein -
  CA924_RS00940 - 207776..208537 (+) 762 WP_126297581.1 hypothetical protein -
  CA924_RS00945 traA 208661..211300 (-) 2640 WP_011212814.1 Ti-type conjugative transfer relaxase TraA -
  CA924_RS00950 - 211549..211755 (+) 207 WP_011212815.1 hypothetical protein -
  CA924_RS00955 - 211742..212011 (+) 270 WP_011212816.1 conjugal transfer protein TraD -
  CA924_RS00960 - 212105..212752 (+) 648 WP_011212817.1 hypothetical protein -
  CA924_RS00965 comEC 212756..213565 (+) 810 WP_011212818.1 hypothetical protein Machinery gene
  CA924_RS00970 - 213592..214053 (-) 462 WP_011212819.1 nucleoside deaminase -
  CA924_RS00975 - 214046..215473 (-) 1428 WP_011212820.1 VUT family protein -
  CA924_RS00980 - 215466..215825 (-) 360 WP_011212821.1 hypothetical protein -
  CA924_RS00985 - 215842..216489 (-) 648 WP_011212822.1 LexA family transcriptional regulator -
  CA924_RS00990 - 216658..216897 (+) 240 WP_011212823.1 hypothetical protein -
  CA924_RS00995 - 216928..217134 (+) 207 WP_011212824.1 hypothetical protein -
  CA924_RS01000 - 217083..218291 (+) 1209 WP_011212825.1 site-specific integrase -
  CA924_RS01005 - 218518..219342 (+) 825 WP_011212826.1 hypothetical protein -

Sequence

Protein


Download         Length: 230 a.a.        Molecular weight: 25773.65 Da        Isoelectric Point: 10.6563

>NTDB_id=229613 CA924_RS00770 WP_011212783.1 165048..165740(+) (rocC) [Legionella pneumophila subsp. pneumophila strain Flint]
MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLRIRPLKIGIMSDILQHAEKAEQVGVSKSKLREAVVL
FTRRLDYLACLKAREVRIDLHGNPVAEVTEEEAENASMKIKKRVEKSVKNARKQVNAKAANHSYVNNQPSTVSSVKPMNS
FDSHPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKAEDKKETTE

Nucleotide


Download         Length: 693 bp        

>NTDB_id=229613 CA924_RS00770 WP_011212783.1 165048..165740(+) (rocC) [Legionella pneumophila subsp. pneumophila strain Flint]
ATGAGAAAGCAGGCGCTGCACCCACGAACCGCTGTCATCAATAAAGCACAAAAAAATCAATCCAAGCGCGCGCGATCTGA
CGCATTATTATGGCTTGCGGCTAATTTCCCTGAGGCATTCGATAATTCTTTGCGTATTCGGCCATTAAAGATTGGTATTA
TGTCTGATATATTGCAGCATGCAGAAAAAGCAGAGCAAGTTGGAGTTTCTAAAAGCAAATTAAGGGAAGCTGTTGTTCTT
TTTACCCGTCGTCTTGATTATCTGGCTTGCCTGAAAGCTCGTGAAGTCCGTATCGATTTGCATGGAAATCCAGTAGCGGA
GGTTACTGAGGAAGAAGCGGAGAATGCTTCCATGAAAATTAAAAAACGCGTGGAAAAGAGTGTTAAAAATGCTCGCAAAC
AAGTGAATGCAAAAGCGGCTAATCATTCATATGTAAATAATCAGCCAAGTACAGTTTCCAGCGTTAAGCCAATGAATTCG
TTTGACTCTCATCCTGAGCCTCTTTTGCCAATATATCCTCTCAGAAGCTCTACCTATGCCTCACAAAATGTGGCAATGCA
ATCCGCCAAGTCACCATCCGTAGTAGTCAAACATAAAGCACCAAAGCAATATGATCCGGATGCTGTAGCTCGTTTAAAAG
AAAAATTAGGATTGTCTCGAAAAGCAGAAGATAAAAAGGAAACAACAGAGTAA

Domains

Predicted by InterproScan.

ProQ/FINO family (ProQ)

(26-132)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rocC Legionella pneumophila str. Paris

100

100

1

Multiple sequence alignment