Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   B9N48_RS12940 Genome accession   NZ_CP021169
Coordinates   2476953..2477363 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain TLO3     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2470055..2491056 2476953..2477363 within 0


Gene organization within MGE regions


Location: 2470055..2491056
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B9N48_RS12900 yqeH 2470055..2471155 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  B9N48_RS12905 yqeG 2471159..2471677 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  B9N48_RS12910 - 2472039..2472179 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  B9N48_RS12915 yqeF 2472485..2473216 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  B9N48_RS12920 cwlH 2473468..2474220 (-) 753 WP_070547555.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  B9N48_RS12925 yqeD 2474407..2475033 (+) 627 WP_077671456.1 TVP38/TMEM64 family protein -
  B9N48_RS12930 gnd 2475053..2475946 (-) 894 WP_077671457.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  B9N48_RS12935 yqeB 2476198..2476920 (+) 723 WP_032726205.1 hypothetical protein -
  B9N48_RS12940 nucA/comI 2476953..2477363 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  B9N48_RS12945 - 2477558..2477923 (+) 366 Protein_2504 sigma-70 family RNA polymerase sigma factor -
  B9N48_RS12950 - 2477967..2478143 (-) 177 Protein_2505 recombinase family protein -
  B9N48_RS20930 - 2478101..2478279 (-) 179 Protein_2506 hypothetical protein -
  B9N48_RS12960 phrE 2478437..2478571 (+) 135 WP_032725165.1 phosphatase RapE inhibitor PhrE -
  B9N48_RS12965 - 2478672..2479248 (-) 577 Protein_2508 N-acetylmuramoyl-L-alanine amidase family protein -
  B9N48_RS12970 - 2479292..2479477 (-) 186 Protein_2509 phage terminase large subunit -
  B9N48_RS12975 terS 2479470..2479991 (-) 522 Protein_2510 phage terminase small subunit -
  B9N48_RS12980 yqaQ 2480004..2480459 (-) 456 WP_086344101.1 hypothetical protein -
  B9N48_RS12985 yqaO 2480521..2480724 (-) 204 Protein_2512 XtrA/YqaO family protein -
  B9N48_RS12990 yqaN 2480806..2481234 (-) 429 WP_086344102.1 RusA family crossover junction endodeoxyribonuclease -
  B9N48_RS12995 - 2481330..2481473 (-) 144 WP_086344103.1 hypothetical protein -
  B9N48_RS13000 - 2481470..2481775 (-) 306 Protein_2515 ATP-binding protein -
  B9N48_RS13005 - 2481803..2482231 (+) 429 Protein_2516 sigma-70 family RNA polymerase sigma factor -
  B9N48_RS20935 - 2482231..2482346 (+) 116 Protein_2517 hypothetical protein -
  B9N48_RS20940 - 2482388..2482492 (-) 105 Protein_2518 hypothetical protein -
  B9N48_RS20945 - 2482561..2482662 (+) 102 Protein_2519 hypothetical protein -
  B9N48_RS13010 yrkJ 2482945..2483730 (-) 786 WP_086344104.1 sulfite exporter TauE/SafE family protein -
  B9N48_RS13015 yrkI 2483790..2484017 (-) 228 WP_012116896.1 sulfurtransferase TusA family protein -
  B9N48_RS13020 yrkH 2484050..2485184 (-) 1135 Protein_2522 MBL fold metallo-hydrolase -
  B9N48_RS20650 - 2485214..2485498 (-) 285 Protein_2523 DsrE/DsrF/DrsH-like family protein -
  B9N48_RS13030 yrkF 2485519..2486076 (-) 558 WP_086344105.1 sulfurtransferase TusA family protein -
  B9N48_RS20950 - 2486142..2486237 (-) 96 Protein_2525 rhodanese-like domain-containing protein -
  B9N48_RS13040 yrkE 2486260..2486742 (-) 483 WP_024572226.1 DsrE/DsrF/DrsH-like family protein -
  B9N48_RS13045 yrkD 2486889..2487149 (-) 261 WP_003237170.1 metal-sensitive transcriptional regulator -
  B9N48_RS20955 - 2487171..2487488 (-) 318 WP_086344106.1 sulfurtransferase -
  B9N48_RS13060 yrkC 2487814..2488374 (-) 561 WP_029318137.1 cupin domain-containing protein -
  B9N48_RS13070 - 2488600..2488743 (-) 144 WP_032722385.1 hypothetical protein -
  B9N48_RS20960 - 2488721..2488906 (-) 186 Protein_2531 hypothetical protein -
  B9N48_RS13075 bltR 2488916..2489737 (-) 822 WP_029727181.1 multidrug efflux transcriptional regulator BltR -
  B9N48_RS13080 blt 2489854..2491056 (+) 1203 WP_086344108.1 multidrug efflux MFS transporter Blt -

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=228783 B9N48_RS12940 WP_009967785.1 2476953..2477363(-) (nucA/comI) [Bacillus subtilis strain TLO3]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=228783 B9N48_RS12940 WP_009967785.1 2476953..2477363(-) (nucA/comI) [Bacillus subtilis strain TLO3]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529

Multiple sequence alignment