Detailed information NTG0227907

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: BL14DL4_RS04285
• Genome accession: NZ_CP026673
• Coordinates: 760168..760605 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain 14ADL4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 755168..765605

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BL14DL4_RS04235 (BL14DL4_00854)	sinI	755343..755519 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
BL14DL4_RS04240 (BL14DL4_00855)	sinR	755553..755888 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
BL14DL4_RS04245 (BL14DL4_00856)	tasA	755993..756787 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
BL14DL4_RS04250 (BL14DL4_00857)	sipW	756861..757445 (-)	585	WP_003183449.1	signal peptidase I SipW	-
BL14DL4_RS04255 (BL14DL4_00858)	tapA	757442..758170 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
BL14DL4_RS04260 (BL14DL4_00859)	-	758447..758767 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
BL14DL4_RS04265 (BL14DL4_00860)	-	758791..758973 (-)	183	WP_003183456.1	YqzE family protein	-
BL14DL4_RS04270 (BL14DL4_00861)	comGG	759062..759427 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
BL14DL4_RS04275 (BL14DL4_00862)	comGF	759440..759928 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
BL14DL4_RS04280	comGE	759837..760184 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
BL14DL4_RS04285 (BL14DL4_00863)	comGD	760168..760605 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
BL14DL4_RS04290 (BL14DL4_00864)	comGC	760611..760904 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
BL14DL4_RS04295 (BL14DL4_00865)	comGB	760918..761952 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
BL14DL4_RS04300 (BL14DL4_00866)	comGA	761942..763006 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
BL14DL4_RS04305 (BL14DL4_00867)	-	763163..764002 (-)	840	WP_003183480.1	STAS domain-containing protein	-
BL14DL4_RS04315 (BL14DL4_00869)	-	764244..764621 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
BL14DL4_RS04320 (BL14DL4_00870)	-	764830..765075 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=227907 BL14DL4_RS04285 WP_009327905.1 760168..760605(-) (comGD) [Bacillus licheniformis strain 14ADL4]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=227907 BL14DL4_RS04285 WP_009327905.1 760168..760605(-) (comGD) [Bacillus licheniformis strain 14ADL4]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCCTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393