Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | B7492_RS22685 | Genome accession | NZ_CP020743 |
| Coordinates | 4336144..4336422 (-) | Length | 92 a.a. |
| NCBI ID | WP_085312362.1 | Uniprot ID | A0A1W6ADB8 |
| Organism | Bacillus mycoides strain Gnyt1 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4302810..4345832 | 4336144..4336422 | within | 0 |
Gene organization within MGE regions
Location: 4302810..4345832
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B7492_RS22465 (B7492_22445) | - | 4302810..4303460 (-) | 651 | WP_002131210.1 | 2OG-Fe(II) oxygenase | - |
| B7492_RS22470 (B7492_22450) | comGG | 4303635..4304006 (-) | 372 | WP_002167676.1 | competence type IV pilus minor pilin ComGG | - |
| B7492_RS22475 (B7492_22455) | - | 4304003..4304329 (-) | 327 | Protein_4393 | competence type IV pilus minor pilin ComGF | - |
| B7492_RS22480 (B7492_22460) | - | 4305253..4306059 (-) | 807 | WP_085312340.1 | GH25 family lysozyme | - |
| B7492_RS22485 (B7492_22465) | - | 4306059..4306271 (-) | 213 | WP_085312341.1 | hypothetical protein | - |
| B7492_RS22490 (B7492_22470) | - | 4306274..4306555 (-) | 282 | WP_085312342.1 | hypothetical protein | - |
| B7492_RS22495 (B7492_22475) | - | 4306569..4307528 (-) | 960 | WP_085312343.1 | site-specific integrase | - |
| B7492_RS22500 (B7492_22480) | - | 4307761..4308210 (-) | 450 | WP_085310643.1 | hypothetical protein | - |
| B7492_RS22505 (B7492_22485) | - | 4308233..4312246 (-) | 4014 | Protein_4399 | phage tail spike protein | - |
| B7492_RS22510 (B7492_22490) | - | 4312243..4313730 (-) | 1488 | WP_085310639.1 | distal tail protein Dit | - |
| B7492_RS22515 (B7492_22495) | - | 4313771..4318780 (-) | 5010 | WP_085310637.1 | phage tail tape measure protein | - |
| B7492_RS22520 (B7492_22500) | - | 4318795..4318935 (-) | 141 | WP_085309278.1 | LysR family transcriptional regulator | - |
| B7492_RS22525 (B7492_22505) | gpG | 4318953..4319342 (-) | 390 | WP_085312344.1 | phage tail assembly chaperone G | - |
| B7492_RS22530 (B7492_22510) | - | 4319410..4319991 (-) | 582 | WP_085309276.1 | major tail protein | - |
| B7492_RS22535 (B7492_22515) | - | 4320005..4320364 (-) | 360 | WP_085309274.1 | structural protein | - |
| B7492_RS22540 (B7492_22520) | - | 4320361..4320795 (-) | 435 | WP_085312345.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| B7492_RS22545 (B7492_22525) | - | 4320783..4321130 (-) | 348 | WP_085309270.1 | phage head closure protein | - |
| B7492_RS22550 (B7492_22530) | - | 4321137..4321388 (-) | 252 | WP_085309268.1 | head-tail connector protein | - |
| B7492_RS22555 (B7492_22535) | - | 4321401..4321655 (-) | 255 | Protein_4409 | fibronectin type III domain-containing protein | - |
| B7492_RS22560 (B7492_22540) | - | 4321681..4322865 (-) | 1185 | WP_085313001.1 | phage major capsid protein | - |
| B7492_RS22565 (B7492_22545) | - | 4322889..4323647 (-) | 759 | WP_085312346.1 | head maturation protease, ClpP-related | - |
| B7492_RS22570 (B7492_22550) | - | 4323625..4324842 (-) | 1218 | WP_085312347.1 | phage portal protein | - |
| B7492_RS22575 (B7492_22555) | - | 4324864..4326636 (-) | 1773 | WP_085310633.1 | terminase large subunit | - |
| B7492_RS22580 (B7492_22560) | - | 4326617..4326997 (-) | 381 | WP_085309258.1 | phage terminase small subunit P27 family | - |
| B7492_RS22585 (B7492_22565) | - | 4327147..4327380 (-) | 234 | WP_085312348.1 | hypothetical protein | - |
| B7492_RS22590 (B7492_22570) | - | 4327394..4327759 (-) | 366 | WP_170972832.1 | HNH endonuclease | - |
| B7492_RS22595 (B7492_22575) | - | 4327740..4327970 (-) | 231 | WP_085309252.1 | hypothetical protein | - |
| B7492_RS22600 (B7492_22580) | - | 4328253..4328465 (-) | 213 | WP_085312350.1 | hypothetical protein | - |
| B7492_RS22605 (B7492_22585) | - | 4328452..4328766 (-) | 315 | WP_407708114.1 | hypothetical protein | - |
| B7492_RS22615 (B7492_22595) | - | 4329408..4329950 (-) | 543 | WP_085312353.1 | site-specific integrase | - |
| B7492_RS22620 (B7492_22600) | - | 4329947..4330417 (-) | 471 | WP_085312354.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| B7492_RS35235 (B7492_22605) | - | 4330438..4330608 (-) | 171 | WP_172805435.1 | hypothetical protein | - |
| B7492_RS22630 (B7492_22610) | - | 4330737..4331033 (-) | 297 | WP_085312356.1 | hypothetical protein | - |
| B7492_RS22635 (B7492_22615) | - | 4331113..4331409 (-) | 297 | WP_085312357.1 | hypothetical protein | - |
| B7492_RS35240 | - | 4332067..4332231 (-) | 165 | WP_172805399.1 | hypothetical protein | - |
| B7492_RS22640 (B7492_22620) | - | 4332390..4333085 (-) | 696 | WP_085312358.1 | hypothetical protein | - |
| B7492_RS22645 (B7492_22625) | - | 4333123..4333521 (-) | 399 | WP_085312359.1 | hypothetical protein | - |
| B7492_RS22650 (B7492_22630) | - | 4333542..4334075 (-) | 534 | WP_085313003.1 | hypothetical protein | - |
| B7492_RS22655 (B7492_22635) | - | 4334111..4334365 (-) | 255 | WP_085312360.1 | hypothetical protein | - |
| B7492_RS22660 (B7492_22640) | - | 4334468..4334767 (+) | 300 | WP_085310015.1 | hypothetical protein | - |
| B7492_RS22665 (B7492_22645) | - | 4334754..4335023 (-) | 270 | WP_085310013.1 | hypothetical protein | - |
| B7492_RS22670 (B7492_22650) | - | 4335061..4335516 (-) | 456 | WP_085310011.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| B7492_RS22675 (B7492_22655) | - | 4335606..4335773 (-) | 168 | WP_042596972.1 | DUF3954 domain-containing protein | - |
| B7492_RS22680 (B7492_22660) | - | 4335792..4336151 (-) | 360 | WP_085312361.1 | cell division protein SepF | - |
| B7492_RS22685 (B7492_22665) | abrB | 4336144..4336422 (-) | 279 | WP_085312362.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| B7492_RS22690 (B7492_22670) | - | 4336439..4336633 (-) | 195 | WP_085312363.1 | hypothetical protein | - |
| B7492_RS22695 (B7492_22675) | - | 4336649..4337512 (-) | 864 | WP_085313004.1 | ATP-binding protein | - |
| B7492_RS22700 (B7492_22680) | - | 4337463..4338257 (-) | 795 | WP_085312364.1 | DnaD domain-containing protein | - |
| B7492_RS22705 (B7492_22685) | - | 4338259..4338438 (-) | 180 | WP_085312365.1 | hypothetical protein | - |
| B7492_RS35245 | - | 4338468..4338632 (-) | 165 | WP_172805436.1 | hypothetical protein | - |
| B7492_RS22710 (B7492_22690) | - | 4338645..4338905 (-) | 261 | WP_061529637.1 | group-specific protein | - |
| B7492_RS35250 | - | 4338926..4339078 (-) | 153 | WP_172805437.1 | DUF6906 family protein | - |
| B7492_RS22715 (B7492_22695) | - | 4339120..4339851 (-) | 732 | WP_085312366.1 | ORF6C domain-containing protein | - |
| B7492_RS22720 (B7492_22700) | - | 4339814..4340086 (-) | 273 | WP_085312367.1 | helix-turn-helix transcriptional regulator | - |
| B7492_RS22725 (B7492_22705) | - | 4340250..4340597 (+) | 348 | WP_016099708.1 | helix-turn-helix domain-containing protein | - |
| B7492_RS22730 (B7492_22710) | - | 4340608..4340790 (-) | 183 | WP_085313005.1 | hypothetical protein | - |
| B7492_RS35255 | - | 4340937..4341086 (-) | 150 | WP_172805438.1 | hypothetical protein | - |
| B7492_RS22735 (B7492_22715) | - | 4341083..4342222 (-) | 1140 | WP_085313006.1 | AimR family lysis-lysogeny pheromone receptor | - |
| B7492_RS22740 (B7492_22720) | - | 4342721..4343074 (+) | 354 | WP_085313007.1 | helix-turn-helix domain-containing protein | - |
| B7492_RS22745 (B7492_22725) | - | 4343263..4343871 (+) | 609 | WP_085312368.1 | hypothetical protein | - |
| B7492_RS35260 | - | 4344210..4344362 (-) | 153 | WP_088068512.1 | hypothetical protein | - |
| B7492_RS22750 (B7492_22730) | - | 4344663..4345832 (+) | 1170 | WP_085312369.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10125.63 Da Isoelectric Point: 5.1584
>NTDB_id=225690 B7492_RS22685 WP_085312362.1 4336144..4336422(-) (abrB) [Bacillus mycoides strain Gnyt1]
MKNTGVARKVDDLGRVVIPVELRRTLGITEGTALDFHVDGENVVLRKQEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDFLQKNVMEHA
MKNTGVARKVDDLGRVVIPVELRRTLGITEGTALDFHVDGENVVLRKQEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDFLQKNVMEHA
Nucleotide
Download Length: 279 bp
>NTDB_id=225690 B7492_RS22685 WP_085312362.1 4336144..4336422(-) (abrB) [Bacillus mycoides strain Gnyt1]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGATCTAGGGCGTGTAGTAATTCCAGTTGAGTTACGCAGAACTTTAGG
GATTACTGAAGGTACAGCATTAGACTTTCATGTTGATGGGGAAAATGTTGTTTTAAGAAAACAAGAAAAGTCATGCTTTG
TAACGGGTGAAGTATCTGAATCCAACATTGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTG
TTGGACTTTCTTCAAAAGAATGTGATGGAACATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGATCTAGGGCGTGTAGTAATTCCAGTTGAGTTACGCAGAACTTTAGG
GATTACTGAAGGTACAGCATTAGACTTTCATGTTGATGGGGAAAATGTTGTTTTAAGAAAACAAGAAAAGTCATGCTTTG
TAACGGGTGAAGTATCTGAATCCAACATTGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTG
TTGGACTTTCTTCAAAAGAATGTGATGGAACATGCCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.471 |
94.565 |
0.543 |