Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   B7492_RS07835 Genome accession   NZ_CP020743
Coordinates   1487485..1487763 (+) Length   92 a.a.
NCBI ID   WP_085310007.1    Uniprot ID   -
Organism   Bacillus mycoides strain Gnyt1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1478989..1506586 1487485..1487763 within 0


Gene organization within MGE regions


Location: 1478989..1506586
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B7492_RS07780 (B7492_07780) - 1478989..1480098 (-) 1110 WP_085309995.1 tyrosine-type recombinase/integrase -
  B7492_RS07785 (B7492_07785) - 1480441..1481589 (+) 1149 WP_085309997.1 AimR family lysis-lysogeny pheromone receptor -
  B7492_RS34500 - 1481593..1481748 (+) 156 WP_153602161.1 hypothetical protein -
  B7492_RS07790 (B7492_07790) - 1481952..1482296 (+) 345 WP_085309999.1 hypothetical protein -
  B7492_RS07795 (B7492_07795) - 1482333..1482995 (+) 663 WP_006926358.1 hypothetical protein -
  B7492_RS34505 - 1483147..1483299 (+) 153 WP_157404891.1 DNA polymerase III subunit delta' -
  B7492_RS07800 (B7492_07800) - 1483306..1483653 (-) 348 WP_085310001.1 helix-turn-helix domain-containing protein -
  B7492_RS07805 (B7492_07805) - 1483830..1484048 (+) 219 WP_033692757.1 helix-turn-helix domain-containing protein -
  B7492_RS07810 (B7492_07810) - 1484108..1484902 (+) 795 WP_085310003.1 phage antirepressor KilAC domain-containing protein -
  B7492_RS07815 (B7492_07815) - 1484917..1485192 (+) 276 WP_085310005.1 helix-turn-helix domain-containing protein -
  B7492_RS34965 - 1485227..1485373 (+) 147 WP_172805407.1 hypothetical protein -
  B7492_RS34970 - 1485421..1485597 (+) 177 WP_172805408.1 hypothetical protein -
  B7492_RS07820 (B7492_07820) - 1485603..1486466 (+) 864 WP_078204460.1 phage replisome organizer N-terminal domain-containing protein -
  B7492_RS07825 (B7492_07825) - 1486408..1487271 (+) 864 WP_078204461.1 ATP-binding protein -
  B7492_RS07830 (B7492_07830) - 1487274..1487468 (+) 195 WP_078204462.1 hypothetical protein -
  B7492_RS07835 (B7492_07835) abrB 1487485..1487763 (+) 279 WP_085310007.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  B7492_RS07840 (B7492_07840) - 1487756..1488115 (+) 360 WP_085310009.1 cell division protein SepF -
  B7492_RS07845 (B7492_07845) - 1488135..1488302 (+) 168 WP_042596972.1 DUF3954 domain-containing protein -
  B7492_RS07850 (B7492_07850) - 1488328..1488579 (+) 252 WP_000109496.1 hypothetical protein -
  B7492_RS07855 (B7492_07855) - 1488599..1489054 (+) 456 WP_085310011.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  B7492_RS07860 (B7492_07860) - 1489092..1489361 (+) 270 WP_085310013.1 hypothetical protein -
  B7492_RS07865 (B7492_07865) - 1489348..1489647 (-) 300 WP_085310015.1 hypothetical protein -
  B7492_RS07870 (B7492_07870) - 1489749..1489943 (+) 195 WP_085312947.1 hypothetical protein -
  B7492_RS07875 (B7492_07875) - 1490247..1491476 (-) 1230 WP_085308762.1 IS110 family transposase -
  B7492_RS07880 (B7492_07880) gpG 1491846..1492163 (+) 318 WP_085310017.1 phage tail assembly chaperone G -
  B7492_RS34510 - 1492193..1492369 (+) 177 WP_157404892.1 hypothetical protein -
  B7492_RS07885 (B7492_07885) - 1492385..1496230 (+) 3846 WP_085310019.1 phage tail tape measure protein -
  B7492_RS07890 (B7492_07890) - 1496245..1497735 (+) 1491 WP_085310022.1 distal tail protein Dit -
  B7492_RS07895 (B7492_07895) - 1497732..1502165 (+) 4434 WP_085310024.1 phage tail spike protein -
  B7492_RS07900 (B7492_07900) - 1502290..1502985 (+) 696 WP_085310026.1 hypothetical protein -
  B7492_RS07905 (B7492_07905) - 1503193..1504152 (+) 960 WP_085310028.1 site-specific integrase -
  B7492_RS07910 (B7492_07910) - 1504168..1504593 (+) 426 WP_085310030.1 holin family protein -
  B7492_RS07915 (B7492_07915) - 1504593..1505399 (+) 807 WP_085310032.1 GH25 family lysozyme -
  B7492_RS07920 (B7492_07920) - 1506191..1506586 (+) 396 WP_016092994.1 DUF3888 domain-containing protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10176.76 Da        Isoelectric Point: 6.2285

>NTDB_id=225676 B7492_RS07835 WP_085310007.1 1487485..1487763(+) (abrB) [Bacillus mycoides strain Gnyt1]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGQVSESNMELLDGRMFLSKEGASEL
LELIEKSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=225676 B7492_RS07835 WP_085310007.1 1487485..1487763(+) (abrB) [Bacillus mycoides strain Gnyt1]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGACGTGTAGTAATTCCGGTTGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGTACAGCGTTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTCAAGTTTCCGAATCAAACATGGAGTTGCTAGACGGCCGGATGTTTTTGAGCAAGGAAGGGGCAAGTGAATTA
CTGGAACTTATTGAAAAGAGCGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

54.945

98.913

0.543

Multiple sequence alignment