Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   C2H93_RS13920 Genome accession   NZ_CP026036
Coordinates   2717662..2717802 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PK5_16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2712662..2722802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H93_RS13895 (C2H93_13895) yuxO 2712984..2713364 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  C2H93_RS13900 (C2H93_13900) comA 2713383..2714027 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  C2H93_RS13905 (C2H93_13905) comP 2714108..2716426 (-) 2319 WP_161621287.1 sensor histidine kinase Regulator
  C2H93_RS13910 (C2H93_13910) comX 2716446..2716622 (-) 177 WP_041906074.1 competence pheromone ComX -
  C2H93_RS13915 (C2H93_13915) comQ 2716637..2717494 (-) 858 WP_309248341.1 polyprenyl synthetase family protein Regulator
  C2H93_RS13920 (C2H93_13920) degQ 2717662..2717802 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  C2H93_RS13925 - 2718024..2718086 (+) 63 Protein_2724 hypothetical protein -
  C2H93_RS13930 (C2H93_13925) - 2718265..2718633 (+) 369 WP_017695529.1 hypothetical protein -
  C2H93_RS13935 (C2H93_13930) pdeH 2718609..2719838 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  C2H93_RS13940 (C2H93_13935) pncB 2719975..2721447 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  C2H93_RS13945 (C2H93_13940) pncA 2721463..2722014 (-) 552 WP_249852272.1 isochorismatase family cysteine hydrolase -
  C2H93_RS13950 (C2H93_13945) yueI 2722111..2722509 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=222547 C2H93_RS13920 WP_003220708.1 2717662..2717802(-) (degQ) [Bacillus subtilis strain PK5_16]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=222547 C2H93_RS13920 WP_003220708.1 2717662..2717802(-) (degQ) [Bacillus subtilis strain PK5_16]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1