Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   C2H91_RS18555 Genome accession   NZ_CP026030
Coordinates   3691583..3691756 (-) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain PK3_9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3686583..3696756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  C2H91_RS18510 (C2H91_18530) comGE 3686933..3687280 (+) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  C2H91_RS18515 (C2H91_18535) comGF 3687306..3687689 (+) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  C2H91_RS18520 (C2H91_18540) comGG 3687690..3688064 (+) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  C2H91_RS18525 (C2H91_18545) spoIIT 3688136..3688315 (+) 180 WP_014480252.1 YqzE family protein -
  C2H91_RS18530 (C2H91_18550) yqzG 3688357..3688683 (-) 327 WP_038829733.1 YqzG/YhdC family protein -
  C2H91_RS18535 (C2H91_18555) tapA 3688954..3689715 (+) 762 WP_077671431.1 amyloid fiber anchoring/assembly protein TapA -
  C2H91_RS18540 (C2H91_18560) sipW 3689699..3690271 (+) 573 WP_003246088.1 signal peptidase I -
  C2H91_RS18545 (C2H91_18565) tasA 3690336..3691121 (+) 786 WP_014477324.1 biofilm matrix protein TasA -
  C2H91_RS18550 (C2H91_18570) sinR 3691214..3691549 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  C2H91_RS18555 (C2H91_18575) sinI 3691583..3691756 (-) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  C2H91_RS18560 (C2H91_18585) yqhG 3691940..3692734 (-) 795 WP_021480015.1 YqhG family protein -
  C2H91_RS18565 (C2H91_18590) yqhH 3692755..3694428 (-) 1674 WP_032726152.1 SNF2-related protein -
  C2H91_RS18570 (C2H91_18595) gcvT 3694870..3695958 (+) 1089 WP_249850939.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=222126 C2H91_RS18555 WP_014477323.1 3691583..3691756(-) (sinI) [Bacillus subtilis strain PK3_9]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=222126 C2H91_RS18555 WP_014477323.1 3691583..3691756(-) (sinI) [Bacillus subtilis strain PK3_9]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982


Multiple sequence alignment