Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BAJT_RS14705 | Genome accession | NZ_CP020375 |
| Coordinates | 2998780..2998920 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain JTYP2 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2993780..3003920
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAJT_RS14680 (BAJT_14680) | - | 2994126..2994509 (-) | 384 | WP_007613430.1 | hotdog fold thioesterase | - |
| BAJT_RS14685 (BAJT_14685) | comA | 2994531..2995175 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| BAJT_RS14690 (BAJT_14690) | comP | 2995256..2997556 (-) | 2301 | WP_032876801.1 | histidine kinase | Regulator |
| BAJT_RS14695 (BAJT_14695) | comX | 2997570..2997743 (-) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| BAJT_RS14700 (BAJT_14700) | - | 2997712..2998572 (-) | 861 | WP_142925231.1 | polyprenyl synthetase family protein | - |
| BAJT_RS14705 (BAJT_14705) | degQ | 2998780..2998920 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| BAJT_RS14715 (BAJT_14715) | - | 2999386..2999727 (+) | 342 | WP_032876795.1 | hypothetical protein | - |
| BAJT_RS14720 (BAJT_14720) | - | 2999734..3000957 (-) | 1224 | WP_032876792.1 | EAL and HDOD domain-containing protein | - |
| BAJT_RS14725 (BAJT_14725) | - | 3001087..3002553 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| BAJT_RS14730 (BAJT_14730) | - | 3002571..3003122 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| BAJT_RS14735 (BAJT_14735) | - | 3003219..3003617 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=221929 BAJT_RS14705 WP_003152043.1 2998780..2998920(-) (degQ) [Bacillus velezensis strain JTYP2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=221929 BAJT_RS14705 WP_003152043.1 2998780..2998920(-) (degQ) [Bacillus velezensis strain JTYP2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |