Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAJT_RS11655 | Genome accession | NZ_CP020375 |
| Coordinates | 2436115..2436288 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain JTYP2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2431115..2441288
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAJT_RS11640 (BAJT_11640) | gcvT | 2431929..2433029 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAJT_RS11645 (BAJT_11645) | - | 2433452..2435122 (+) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| BAJT_RS11650 (BAJT_11650) | - | 2435144..2435938 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| BAJT_RS11655 (BAJT_11655) | sinI | 2436115..2436288 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| BAJT_RS11660 (BAJT_11660) | sinR | 2436322..2436657 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAJT_RS11665 (BAJT_11665) | tasA | 2436705..2437490 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| BAJT_RS11670 (BAJT_11670) | sipW | 2437555..2438139 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| BAJT_RS11675 (BAJT_11675) | tapA | 2438111..2438782 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAJT_RS11680 (BAJT_11680) | - | 2439041..2439370 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| BAJT_RS11685 (BAJT_11685) | - | 2439411..2439590 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| BAJT_RS11690 (BAJT_11690) | comGG | 2439647..2440024 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAJT_RS11695 (BAJT_11695) | comGF | 2440025..2440525 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| BAJT_RS11700 (BAJT_11700) | comGE | 2440434..2440748 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAJT_RS11705 (BAJT_11705) | comGD | 2440732..2441169 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=221907 BAJT_RS11655 WP_032874029.1 2436115..2436288(+) (sinI) [Bacillus velezensis strain JTYP2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=221907 BAJT_RS11655 WP_032874029.1 2436115..2436288(+) (sinI) [Bacillus velezensis strain JTYP2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |