Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   EC780_RS19280 Genome accession   NZ_CP020106
Coordinates   3514839..3515468 (-) Length   209 a.a.
NCBI ID   WP_000839145.1    Uniprot ID   -
Organism   Escherichia coli strain 13E0780     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3494257..3531684 3514839..3515468 within 0


Gene organization within MGE regions


Location: 3494257..3531684
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EC780_RS19125 (EC780_19130) - 3494319..3494582 (-) 264 WP_000224233.1 hypothetical protein -
  EC780_RS19130 (EC780_19135) - 3494584..3494801 (-) 218 Protein_3528 DUF4014 family protein -
  EC780_RS19135 (EC780_19140) - 3494834..3495046 (-) 213 WP_000935420.1 hypothetical protein -
  EC780_RS19140 (EC780_19145) - 3495097..3495453 (-) 357 WP_000403777.1 hypothetical protein -
  EC780_RS19145 (EC780_19150) - 3495431..3495892 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  EC780_RS19150 (EC780_19155) - 3495889..3496185 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  EC780_RS19155 (EC780_19160) - 3496182..3496604 (-) 423 WP_001151153.1 DUF977 family protein -
  EC780_RS19160 (EC780_19165) - 3496645..3497715 (-) 1071 WP_001262389.1 hypothetical protein -
  EC780_RS19165 (EC780_19170) - 3497787..3498212 (-) 426 WP_000693949.1 toxin YdaT family protein -
  EC780_RS19170 (EC780_19175) - 3498209..3498424 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  EC780_RS19175 (EC780_19180) - 3498474..3499190 (+) 717 WP_000103686.1 S24 family peptidase -
  EC780_RS19185 (EC780_19190) - 3499463..3499615 (+) 153 WP_000379580.1 DUF1391 family protein -
  EC780_RS19190 (EC780_19195) - 3499627..3500001 (+) 375 WP_000394557.1 hypothetical protein -
  EC780_RS19200 (EC780_19205) dicB 3500533..3500721 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  EC780_RS19205 (EC780_19210) - 3500718..3500909 (+) 192 WP_001090200.1 DUF1482 family protein -
  EC780_RS19210 (EC780_19215) - 3501002..3503473 (+) 2472 WP_064482952.1 exonuclease -
  EC780_RS19215 (EC780_19220) - 3503541..3503783 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  EC780_RS19220 (EC780_19225) - 3503761..3504780 (+) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  EC780_RS19225 (EC780_19230) yccA 3505188..3505847 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  EC780_RS19230 (EC780_19235) tusE 3505938..3506267 (+) 330 WP_001397075.1 sulfurtransferase TusE -
  EC780_RS19235 (EC780_19240) yccX 3506264..3506542 (-) 279 WP_000048233.1 acylphosphatase -
  EC780_RS19240 (EC780_19245) rlmI 3506637..3507827 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  EC780_RS19245 (EC780_19250) hspQ 3507885..3508202 (+) 318 WP_001295356.1 heat shock protein HspQ -
  EC780_RS19250 (EC780_19255) yccU 3508247..3508660 (-) 414 WP_032314554.1 CoA-binding protein -
  EC780_RS19255 (EC780_19260) yccT 3508833..3509495 (+) 663 WP_000847791.1 DUF2057 family protein -
  EC780_RS19260 (EC780_19265) mgsA 3509591..3510049 (+) 459 WP_000424181.1 methylglyoxal synthase -
  EC780_RS19265 (EC780_19270) helD 3510081..3512135 (-) 2055 WP_001397074.1 DNA helicase IV -
  EC780_RS19270 (EC780_19275) yccF 3512258..3512704 (+) 447 WP_001261235.1 YccF domain-containing protein -
  EC780_RS19275 (EC780_19280) yccS 3512714..3514876 (+) 2163 WP_000875026.1 YccS family putative transporter -
  EC780_RS19280 (EC780_19285) sxy/tfoX 3514839..3515468 (-) 630 WP_000839145.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  EC780_RS19285 (EC780_19290) sulA 3515687..3516196 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  EC780_RS19295 (EC780_19300) ompA 3516553..3517593 (+) 1041 WP_000750416.1 porin OmpA -
  EC780_RS19300 (EC780_19305) matP 3517669..3518121 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  EC780_RS19305 (EC780_19310) ycbZ 3518307..3520067 (+) 1761 WP_032314553.1 Lon protease family protein -
  EC780_RS19310 (EC780_19315) fabA 3520136..3520654 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  EC780_RS19315 (EC780_19320) rmf 3520724..3520891 (-) 168 WP_000828648.1 ribosome modulation factor -
  EC780_RS19320 (EC780_19325) pqiC 3521147..3521710 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  EC780_RS19325 (EC780_19330) pqiB 3521707..3523347 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  EC780_RS19330 (EC780_19335) pqiA 3523352..3524605 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  EC780_RS19335 (EC780_19340) uup 3524735..3526642 (-) 1908 WP_000053119.1 ABC transporter ATP-binding protein -
  EC780_RS19340 (EC780_19345) rlmKL 3526654..3528762 (-) 2109 WP_001086550.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  EC780_RS19345 (EC780_19350) ycbX 3529006..3530115 (+) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  EC780_RS19350 (EC780_19355) zapC 3530112..3530654 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24132.99 Da        Isoelectric Point: 9.2180

>NTDB_id=221248 EC780_RS19280 WP_000839145.1 3514839..3515468(-) (sxy/tfoX) [Escherichia coli strain 13E0780]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRDRLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=221248 EC780_RS19280 WP_000839145.1 3514839..3515468(-) (sxy/tfoX) [Escherichia coli strain 13E0780]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGATAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGTCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(116-194)

TfoX N-terminal domain (TfoX_N)

(14-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment