Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   B4U62_RS13895 Genome accession   NZ_CP020102
Coordinates   2652408..2652818 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain NCIB 3610     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2647774..2699264 2652408..2652818 within 0


Gene organization within MGE regions


Location: 2647774..2699264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  B4U62_RS13870 (B4U62_13870) yqeF 2647941..2648672 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  B4U62_RS13875 (B4U62_13875) cwlH 2648924..2649676 (-) 753 WP_003229963.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  B4U62_RS13880 (B4U62_13880) yqeD 2649863..2650489 (+) 627 WP_003229962.1 TVP38/TMEM64 family protein -
  B4U62_RS13885 (B4U62_13885) gnd 2650508..2651401 (-) 894 WP_003229961.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  B4U62_RS13890 (B4U62_13890) yqeB 2651653..2652375 (+) 723 WP_010886572.1 hypothetical protein -
  B4U62_RS13895 (B4U62_13895) nucA/comI 2652408..2652818 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  B4U62_RS13900 (B4U62_13900) - 2653014..2653361 (+) 348 Protein_2700 sigma-70 family RNA polymerase sigma factor -
  B4U62_RS13905 (B4U62_13905) spoIVCA 2653392..2654852 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  B4U62_RS23130 (B4U62_13910) - 2654810..2654988 (-) 179 Protein_2702 hypothetical protein -
  B4U62_RS13915 (B4U62_13915) arsC 2655343..2655762 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  B4U62_RS13920 (B4U62_13920) acr3 2655774..2656814 (-) 1041 WP_004398718.1 arsenite efflux transporter Acr3 -
  B4U62_RS13925 (B4U62_13925) arsK 2656837..2657277 (-) 441 WP_003229954.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  B4U62_RS13930 (B4U62_13930) arsR 2657338..2657655 (-) 318 WP_004399122.1 arsenical resistance operon transcriptional regulator ArsR -
  B4U62_RS13935 (B4U62_13935) yqcI 2658027..2658791 (-) 765 WP_004398670.1 YqcI/YcgG family protein -
  B4U62_RS13940 (B4U62_13940) rapE 2659234..2660361 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  B4U62_RS13945 (B4U62_13945) phrE 2660351..2660485 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  B4U62_RS13950 (B4U62_13950) - 2660595..2660753 (+) 159 WP_003245945.1 hypothetical protein -
  B4U62_RS13955 (B4U62_13955) yqcG 2661123..2662718 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  B4U62_RS13960 (B4U62_13960) yqcF 2662733..2663311 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  B4U62_RS22855 - 2663429..2663575 (+) 147 WP_009967791.1 hypothetical protein -
  B4U62_RS13965 (B4U62_13965) - 2663572..2663934 (-) 363 WP_003229947.1 hypothetical protein -
  B4U62_RS13970 (B4U62_13970) - 2663950..2664429 (-) 480 WP_004399085.1 hypothetical protein -
  B4U62_RS13975 (B4U62_13975) cwlA 2664594..2665412 (-) 819 WP_003229946.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  B4U62_RS13980 (B4U62_13980) skhD 2665457..2665879 (-) 423 WP_003246208.1 holin family protein -
  B4U62_RS13985 (B4U62_13985) xepAK 2665924..2666817 (-) 894 WP_003246010.1 hypothetical protein -
  B4U62_RS13990 (B4U62_13990) yqcE 2666905..2667069 (-) 165 WP_003229944.1 XkdX family protein -
  B4U62_RS13995 (B4U62_13995) yqcD 2667066..2667401 (-) 336 WP_009967793.1 XkdW family protein -
  B4U62_RS14000 (B4U62_14000) yqcC 2667411..2668511 (-) 1101 WP_003229943.1 pyocin knob domain-containing protein -
  B4U62_RS14005 (B4U62_14005) - 2668514..2668786 (-) 273 WP_003229942.1 hypothetical protein -
  B4U62_RS14010 (B4U62_14010) yqcA 2668783..2669361 (-) 579 WP_003229941.1 YmfQ family protein -
  B4U62_RS14015 (B4U62_14015) yqbT 2669345..2670391 (-) 1047 WP_003229940.1 baseplate J/gp47 family protein -
  B4U62_RS14020 (B4U62_14020) yqbS 2670384..2670809 (-) 426 WP_004398572.1 DUF2634 domain-containing protein -
  B4U62_RS14025 (B4U62_14025) yqbR 2670822..2671085 (-) 264 WP_003229938.1 DUF2577 family protein -
  B4U62_RS14030 (B4U62_14030) yqbQ 2671082..2672062 (-) 981 WP_004398524.1 hypothetical protein -
  B4U62_RS14035 (B4U62_14035) yqbP 2672075..2672734 (-) 660 WP_004398548.1 LysM peptidoglycan-binding domain-containing protein -
  B4U62_RS14040 (B4U62_14040) yqbO 2672727..2677484 (-) 4758 WP_003246092.1 phage tail tape measure protein -
  B4U62_RS14045 (B4U62_14045) - 2677487..2677624 (-) 138 WP_003229934.1 hypothetical protein -
  B4U62_RS14050 (B4U62_14050) - 2677666..2678115 (-) 450 WP_003229933.1 phage portal protein -
  B4U62_RS14055 (B4U62_14055) txpA 2678261..2678440 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  B4U62_RS22640 bsrH 2678820..2678909 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  B4U62_RS14065 (B4U62_14065) yqbM 2679163..2679606 (-) 444 WP_003229930.1 phage tail tube protein -
  B4U62_RS14070 (B4U62_14070) yqbK 2679609..2681009 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  B4U62_RS14075 (B4U62_14075) - 2681010..2681201 (-) 192 WP_010886574.1 hypothetical protein -
  B4U62_RS14080 (B4U62_14080) yqbJ 2681198..2681635 (-) 438 WP_003229927.1 DUF6838 family protein -
  B4U62_RS14085 (B4U62_14085) yqbI 2681648..2682151 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  B4U62_RS14090 (B4U62_14090) yqbH 2682148..2682510 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  B4U62_RS14095 (B4U62_14095) gkpG 2682507..2682902 (-) 396 WP_004398566.1 DUF3199 family protein -
  B4U62_RS14100 (B4U62_14100) yqbF 2682906..2683217 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  B4U62_RS14105 (B4U62_14105) skdG 2683228..2684163 (-) 936 WP_003229922.1 phage major capsid protein -
  B4U62_RS14110 (B4U62_14110) yqbD 2684182..2685150 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  B4U62_RS14115 (B4U62_14115) - 2685183..2685836 (-) 654 WP_003229920.1 hypothetical protein -
  B4U62_RS14120 (B4U62_14120) yqbB 2685877..2686794 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  B4U62_RS14125 (B4U62_14125) yqbA 2686791..2688323 (-) 1533 WP_004398894.1 phage portal protein -
  B4U62_RS14130 (B4U62_14130) stmB 2688327..2689622 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  B4U62_RS14135 (B4U62_14135) terS 2689615..2690334 (-) 720 WP_003229916.1 phage terminase small subunit -
  B4U62_RS14140 (B4U62_14140) - 2690402..2690866 (-) 465 WP_004398685.1 hypothetical protein -
  B4U62_RS14145 (B4U62_14145) yqaQ 2691010..2691465 (-) 456 WP_004398775.1 hypothetical protein -
  B4U62_RS14150 (B4U62_14150) - 2691663..2692592 (+) 930 WP_003229913.1 hypothetical protein -
  B4U62_RS14155 (B4U62_14155) yqaO 2692666..2692872 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  B4U62_RS14160 (B4U62_14160) yqaN 2692954..2693382 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  B4U62_RS14165 (B4U62_14165) - 2693478..2693627 (-) 150 WP_003229910.1 hypothetical protein -
  B4U62_RS14170 (B4U62_14170) sknM 2693618..2694559 (-) 942 WP_075058863.1 ATP-binding protein -
  B4U62_RS14175 (B4U62_14175) yqaL 2694441..2695118 (-) 678 WP_010886575.1 DnaD domain protein -
  B4U62_RS14180 (B4U62_14180) recT 2695194..2696048 (-) 855 WP_003229907.1 recombinase RecT -
  B4U62_RS14185 (B4U62_14185) yqaJ 2696051..2697010 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  B4U62_RS14190 (B4U62_14190) - 2697116..2697310 (-) 195 WP_003229905.1 hypothetical protein -
  B4U62_RS22860 - 2697270..2697443 (-) 174 WP_119123069.1 hypothetical protein -
  B4U62_RS14195 (B4U62_14195) sknH 2697440..2697697 (-) 258 WP_003245994.1 YqaH family protein -
  B4U62_RS14200 (B4U62_14200) yqaG 2697694..2698263 (-) 570 WP_004398626.1 helix-turn-helix transcriptional regulator -
  B4U62_RS14205 (B4U62_14205) - 2698337..2698477 (-) 141 WP_003229902.1 hypothetical protein -
  B4U62_RS14210 (B4U62_14210) yqaF 2698507..2698737 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  B4U62_RS14215 (B4U62_14215) sknR 2698914..2699264 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=221181 B4U62_RS13895 WP_009967785.1 2652408..2652818(-) (nucA/comI) [Bacillus subtilis strain NCIB 3610]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=221181 B4U62_RS13895 WP_009967785.1 2652408..2652818(-) (nucA/comI) [Bacillus subtilis strain NCIB 3610]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529


Multiple sequence alignment