Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   EC725_RS17765 Genome accession   NZ_CP020092
Coordinates   3310463..3311092 (-) Length   209 a.a.
NCBI ID   WP_000839145.1    Uniprot ID   -
Organism   Escherichia coli strain 13E0725     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3289881..3327302 3310463..3311092 within 0


Gene organization within MGE regions


Location: 3289881..3327302
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EC725_RS17610 (EC725_17615) - 3289943..3290206 (-) 264 WP_000224233.1 hypothetical protein -
  EC725_RS17615 (EC725_17620) - 3290208..3290425 (-) 218 Protein_3252 DUF4014 family protein -
  EC725_RS17620 (EC725_17625) - 3290458..3290670 (-) 213 WP_000935420.1 hypothetical protein -
  EC725_RS17625 (EC725_17630) - 3290721..3291077 (-) 357 WP_000403777.1 hypothetical protein -
  EC725_RS17630 (EC725_17635) - 3291055..3291516 (-) 462 WP_001209480.1 sigma-E factor regulatory protein RseB domain-containing protein -
  EC725_RS17635 (EC725_17640) - 3291513..3291809 (-) 297 WP_001266134.1 DUF4406 domain-containing protein -
  EC725_RS17640 (EC725_17645) - 3291806..3292228 (-) 423 WP_001151153.1 DUF977 family protein -
  EC725_RS17645 (EC725_17650) - 3292269..3293339 (-) 1071 WP_001262389.1 hypothetical protein -
  EC725_RS17650 (EC725_17655) - 3293411..3293836 (-) 426 WP_000693949.1 toxin YdaT family protein -
  EC725_RS17655 (EC725_17660) - 3293833..3294048 (-) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  EC725_RS17660 (EC725_17665) - 3294098..3294814 (+) 717 WP_000103686.1 S24 family peptidase -
  EC725_RS17670 (EC725_17675) - 3295087..3295239 (+) 153 WP_000379580.1 DUF1391 family protein -
  EC725_RS17675 (EC725_17680) - 3295251..3295625 (+) 375 WP_000394557.1 hypothetical protein -
  EC725_RS17685 (EC725_17690) dicB 3296157..3296345 (+) 189 WP_000449192.1 cell division inhibition protein DicB -
  EC725_RS17690 (EC725_17695) - 3296342..3296533 (+) 192 WP_001090200.1 DUF1482 family protein -
  EC725_RS17695 (EC725_17700) - 3296626..3299097 (+) 2472 WP_064482952.1 exonuclease -
  EC725_RS17700 (EC725_17705) - 3299165..3299407 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  EC725_RS17705 (EC725_17710) - 3299385..3300404 (+) 1020 WP_001299701.1 tyrosine-type recombinase/integrase -
  EC725_RS17710 (EC725_17715) yccA 3300812..3301471 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  EC725_RS17715 (EC725_17720) tusE 3301562..3301891 (+) 330 WP_001397075.1 sulfurtransferase TusE -
  EC725_RS17720 (EC725_17725) yccX 3301888..3302166 (-) 279 WP_000048233.1 acylphosphatase -
  EC725_RS17725 (EC725_17730) rlmI 3302261..3303451 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  EC725_RS17730 (EC725_17735) hspQ 3303509..3303826 (+) 318 WP_001295356.1 heat shock protein HspQ -
  EC725_RS17735 (EC725_17740) yccU 3303871..3304284 (-) 414 WP_032314554.1 CoA-binding protein -
  EC725_RS17740 (EC725_17745) yccT 3304457..3305119 (+) 663 WP_000847791.1 DUF2057 family protein -
  EC725_RS17745 (EC725_17750) mgsA 3305215..3305673 (+) 459 WP_000424181.1 methylglyoxal synthase -
  EC725_RS17750 (EC725_17755) helD 3305705..3307759 (-) 2055 WP_001397074.1 DNA helicase IV -
  EC725_RS17755 (EC725_17760) yccF 3307882..3308328 (+) 447 WP_001261235.1 YccF domain-containing protein -
  EC725_RS17760 (EC725_17765) yccS 3308338..3310500 (+) 2163 WP_000875026.1 YccS family putative transporter -
  EC725_RS17765 (EC725_17770) sxy/tfoX 3310463..3311092 (-) 630 WP_000839145.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  EC725_RS17770 (EC725_17775) sulA 3311311..3311820 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  EC725_RS17780 (EC725_17785) ompA 3312177..3313217 (+) 1041 WP_000750416.1 porin OmpA -
  EC725_RS17785 (EC725_17790) matP 3313293..3313745 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  EC725_RS17790 (EC725_17795) ycbZ 3313931..3315691 (+) 1761 WP_032314553.1 Lon protease family protein -
  EC725_RS17795 (EC725_17800) fabA 3315760..3316278 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  EC725_RS17800 (EC725_17805) rmf 3316348..3316515 (-) 168 WP_000828648.1 ribosome modulation factor -
  EC725_RS17805 (EC725_17810) pqiC 3316771..3317334 (-) 564 WP_000759129.1 membrane integrity-associated transporter subunit PqiC -
  EC725_RS17810 (EC725_17815) pqiB 3317331..3318971 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  EC725_RS17815 (EC725_17820) pqiA 3318976..3320229 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  EC725_RS17820 (EC725_17825) uup 3320359..3322266 (-) 1908 WP_000053119.1 ABC transporter ATP-binding protein -
  EC725_RS17825 (EC725_17830) rlmKL 3322278..3324386 (-) 2109 WP_001086550.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  EC725_RS17830 (EC725_17835) ycbX 3324630..3325739 (+) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  EC725_RS17835 (EC725_17840) zapC 3325736..3326278 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24132.99 Da        Isoelectric Point: 9.2180

>NTDB_id=221037 EC725_RS17765 WP_000839145.1 3310463..3311092(-) (sxy/tfoX) [Escherichia coli strain 13E0725]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRDRLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=221037 EC725_RS17765 WP_000839145.1 3310463..3311092(-) (sxy/tfoX) [Escherichia coli strain 13E0725]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGATAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGTCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(116-194)

TfoX N-terminal domain (TfoX_N)

(14-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.522

100

0.995

Multiple sequence alignment