Detailed information NTG0021985

Bioinformatically predicted

Overview

• Name: pilJ
• Type: Machinery gene
• Locus tag: TTE_RS14605
• Genome accession: NC_003869
• Coordinates: 1061173..1061343 (+)
• Length: 56 a.a.
• NCBI ID: WP_407636726.1
• Uniprot ID: -
• Organism: Caldanaerobacter subterraneus subsp. tengcongensis MB4
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1056173..1066343

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
TTE_RS05075 (TTE1054)	-	1057112..1058395 (+)	1284	WP_011024548.1	IS110 family transposase	-
TTE_RS05080 (TTE1055)	-	1059022..1060371 (+)	1350	WP_011025416.1	HD domain-containing protein	-
TTE_RS14200 (TTE1056)	-	1060434..1060847 (+)	414	WP_011025417.1	methyl-accepting chemotaxis protein	-
TTE_RS14605	pilJ	1061173..1061343 (+)	171	WP_407636726.1	methyl-accepting chemotaxis protein	Machinery gene
TTE_RS13915 (TTE1057)	-	1061475..1061684 (+)	210	WP_157858513.1	hypothetical protein	-
TTE_RS05095 (TTE1059)	-	1062385..1062636 (+)	252	WP_011025420.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
TTE_RS05100 (TTE1060)	-	1062620..1063033 (+)	414	WP_011025421.1	type II toxin-antitoxin system VapC family toxin	-
TTE_RS05105 (TTE1061)	-	1063119..1063316 (+)	198	WP_011025422.1	helix-turn-helix domain-containing protein	-
TTE_RS14610 (TTE1062)	-	1063400..1063591 (+)	192	WP_011025423.1	helix-turn-helix domain-containing protein	-
TTE_RS05115 (TTE1063)	-	1064246..1064632 (+)	387	WP_011025424.1	response regulator	-
TTE_RS13770 (TTE1065)	-	1065298..1065683 (+)	386	Protein_1016	transposase	-

Sequence

Protein

• Length: 56 a.a.
• Molecular weight: 6077.81 Da
• Isoelectric Point: 4.3059

>NTDB_id=21985 TTE_RS14605 WP_407636726.1 1061173..1061343(+) (pilJ) [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
MTNVITSISEQTNLLALNTTIEAARAGEAERGFAVVAEEVRKLAEESKKSTNEIIE

Nucleotide

• Length: 171 bp

>NTDB_id=21985 TTE_RS14605 WP_407636726.1 1061173..1061343(+) (pilJ) [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
ATAACCAATGTAATAACATCAATATCAGAACAAACAAACCTTCTAGCATTAAATACGACTATCGAAGCAGCCAGGGCTGG
AGAAGCTGAAAGAGGATTTGCAGTGGTTGCTGAAGAAGTTAGAAAGCTTGCGGAAGAATCTAAAAAATCAACCAACGAAA
TAATTGAATAA

Domains

Predicted by InterproScan.

• Methyl-accepting chemotaxis protein (MCP) signalling domain (MCPsignal) (2-54)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilJ	Synechocystis sp. PCC 6803	66.667	91.071	0.607