Detailed information    

insolico Bioinformatically predicted

Overview

Name   treR   Type   Regulator
Locus tag   SPYM18_RS09235 Genome accession   NC_003485
Coordinates   1811039..1811752 (+) Length   237 a.a.
NCBI ID   WP_002992823.1    Uniprot ID   -
Organism   Streptococcus pyogenes MGAS8232     
Function   regulate expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1806706..1875030 1811039..1811752 within 0


Gene organization within MGE regions


Location: 1806706..1875030
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SPYM18_RS09225 (spyM18_2154) treC 1807108..1808736 (-) 1629 WP_011018305.1 alpha,alpha-phosphotrehalase -
  SPYM18_RS09230 (spyM18_2155) treP 1808804..1810828 (-) 2025 WP_011018306.1 PTS system trehalose-specific EIIBC component -
  SPYM18_RS09235 (spyM18_2157) treR 1811039..1811752 (+) 714 WP_002992823.1 trehalose operon repressor Regulator
  SPYM18_RS09240 (spyM18_2160) - 1812031..1812369 (-) 339 WP_011018307.1 winged helix-turn-helix transcriptional regulator -
  SPYM18_RS09245 - 1812555..1813412 (+) 858 Protein_1801 VOC family protein -
  SPYM18_RS09250 (spyM18_2163) yaaA 1813454..1814185 (+) 732 WP_011018309.1 peroxide stress protein YaaA -
  SPYM18_RS09255 (spyM18_2164) nrdG 1814359..1814973 (-) 615 WP_011018310.1 anaerobic ribonucleoside-triphosphate reductase activating protein -
  SPYM18_RS09260 (spyM18_2165) - 1814973..1815482 (-) 510 WP_011018311.1 GNAT family N-acetyltransferase -
  SPYM18_RS09265 (spyM18_2166) - 1815491..1816426 (-) 936 WP_011018312.1 Gfo/Idh/MocA family protein -
  SPYM18_RS10415 (spyM18_2167) - 1816455..1816601 (-) 147 WP_002982210.1 hypothetical protein -
  SPYM18_RS09270 (spyM18_2168) nrdD 1816783..1818981 (-) 2199 WP_002992831.1 anaerobic ribonucleoside-triphosphate reductase -
  SPYM18_RS09275 (spyM18_2169) - 1819078..1820637 (-) 1560 WP_002992833.1 membrane protein -
  SPYM18_RS09280 (spyM18_2170) - 1821050..1821355 (-) 306 WP_002982199.1 DUF1292 domain-containing protein -
  SPYM18_RS09285 (spyM18_2171) ruvX 1821367..1821786 (-) 420 WP_002982196.1 Holliday junction resolvase RuvX -
  SPYM18_RS09290 (spyM18_2172) - 1821783..1822052 (-) 270 WP_002982194.1 IreB family regulatory phosphoprotein -
  SPYM18_RS09295 (spyM18_2173) spx 1822165..1822563 (-) 399 WP_002982188.1 transcriptional regulator Spx -
  SPYM18_RS09300 (spyM18_2174) recA 1822854..1823990 (-) 1137 WP_002982186.1 recombinase RecA Machinery gene
  SPYM18_RS09305 (spyM18_2175) cinA 1824079..1825350 (-) 1272 WP_011018313.1 competence/damage-inducible protein A Machinery gene
  SPYM18_RS09310 (spyM18_2176) - 1825419..1825979 (-) 561 WP_011018314.1 DNA-3-methyladenine glycosylase I -
  SPYM18_RS09315 (spyM18_2177) ruvA 1825989..1826585 (-) 597 WP_011018315.1 Holliday junction branch migration protein RuvA -
  SPYM18_RS09320 (spyM18_2178) - 1826587..1827807 (-) 1221 WP_011018316.1 MDR family MFS transporter -
  SPYM18_RS09325 (spyM18_2179) mutL 1827818..1829800 (-) 1983 WP_011018317.1 DNA mismatch repair endonuclease MutL -
  SPYM18_RS09330 (spyM18_2180) mutS 1829929..1832484 (-) 2556 WP_011018318.1 DNA mismatch repair protein MutS -
  SPYM18_RS10720 - 1832471..1832823 (-) 353 Protein_1820 YlbF family regulator -
  SPYM18_RS09340 (spyM18_2182) argR 1832820..1833257 (-) 438 WP_002982171.1 arginine repressor -
  SPYM18_RS09345 (spyM18_2183) argS 1833548..1835239 (+) 1692 WP_011018320.1 arginine--tRNA ligase -
  SPYM18_RS09350 (spyM18_2184) - 1835327..1835635 (+) 309 WP_002991370.1 bacteriocin immunity protein -
  SPYM18_RS09355 (spyM18_2185) - 1835662..1836534 (-) 873 WP_002982164.1 YitT family protein -
  SPYM18_RS09360 (spyM18_2186) - 1836577..1837455 (-) 879 WP_011018321.1 YitT family protein -
  SPYM18_RS09365 (spyM18_2187) - 1837475..1838416 (-) 942 WP_010922775.1 YitT family protein -
  SPYM18_RS09370 (spyM18_2188) aspS 1838409..1840157 (-) 1749 WP_009880608.1 aspartate--tRNA ligase -
  SPYM18_RS09375 (spyM18_2189) hisS 1840495..1841775 (-) 1281 WP_011018322.1 histidine--tRNA ligase -
  SPYM18_RS09380 (spyM18_2190) - 1841984..1842976 (+) 993 WP_011018323.1 IS30-like element IS1239 family transposase -
  SPYM18_RS09385 (spyM18_2196) rpmF 1843081..1843263 (+) 183 WP_000290414.1 50S ribosomal protein L32 -
  SPYM18_RS09390 (spyM18_2197) rpmG 1843279..1843428 (+) 150 WP_002982147.1 50S ribosomal protein L33 -
  SPYM18_RS10585 - 1843511..1843693 (-) 183 Protein_1832 hypothetical protein -
  SPYM18_RS09400 (spyM18_2198) - 1843722..1844336 (+) 615 WP_000615739.1 CadD family cadmium resistance transporter -
  SPYM18_RS09405 (spyM18_2199) cadX 1844348..1844686 (+) 339 WP_000711093.1 Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX -
  SPYM18_RS09415 - 1844730..1845632 (+) 903 Protein_1835 XRE family transcriptional regulator -
  SPYM18_RS09420 (spyM18_2201) - 1845626..1846460 (+) 835 Protein_1836 ABC transporter ATP-binding protein -
  SPYM18_RS09425 (spyM18_2203) - 1846457..1847059 (+) 603 WP_011018327.1 hypothetical protein -
  SPYM18_RS10220 - 1847534..1847755 (-) 222 WP_226976787.1 transcriptional regulator -
  SPYM18_RS10790 - 1847822..1847866 (-) 45 Protein_1839 hypothetical protein -
  SPYM18_RS09435 (spyM18_2207) - 1848269..1849111 (+) 843 WP_003062683.1 DUF368 domain-containing protein -
  SPYM18_RS09440 - 1849158..1849799 (-) 642 WP_023079624.1 NUDIX hydrolase -
  SPYM18_RS09445 (spyM18_2210) - 1850006..1850332 (+) 327 WP_002982104.1 PadR family transcriptional regulator -
  SPYM18_RS09450 (spyM18_2211) - 1850319..1850906 (+) 588 WP_011018329.1 DUF1700 domain-containing protein -
  SPYM18_RS09455 (spyM18_2212) - 1850903..1851985 (+) 1083 WP_011018330.1 DUF4097 family beta strand repeat-containing protein -
  SPYM18_RS09460 (spyM18_2213) - 1852054..1854327 (-) 2274 WP_011018331.1 YhgE/Pip domain-containing protein -
  SPYM18_RS09465 (spyM18_2214) - 1854462..1854995 (+) 534 WP_002991404.1 TetR/AcrR family transcriptional regulator -
  SPYM18_RS09470 (spyM18_2215) rpsD 1855151..1855762 (-) 612 WP_002982092.1 30S ribosomal protein S4 -
  SPYM18_RS09475 (spyM18_2216) - 1856491..1856763 (-) 273 WP_002991405.1 Veg family protein -
  SPYM18_RS09480 (spyM18_2217) dnaB 1856780..1858147 (-) 1368 WP_011889251.1 replicative DNA helicase -
  SPYM18_RS09485 (spyM18_2218) rplI 1858177..1858629 (-) 453 WP_002982086.1 50S ribosomal protein L9 -
  SPYM18_RS09490 (spyM18_2219) - 1858626..1860602 (-) 1977 WP_011018333.1 DHH family phosphoesterase -
  SPYM18_RS09495 (spyM18_2220) mnmG 1860692..1862590 (-) 1899 WP_011018334.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  SPYM18_RS09500 (spyM18_2221) - 1862735..1863031 (-) 297 WP_011018335.1 NUDIX domain-containing protein -
  SPYM18_RS09505 (spyM18_2222) mnmA 1863809..1864930 (-) 1122 WP_023079620.1 tRNA 2-thiouridine(34) synthase MnmA -
  SPYM18_RS09510 (spyM18_2224) sdaAB 1865228..1865899 (+) 672 WP_002982075.1 L-serine ammonia-lyase, iron-sulfur-dependent subunit beta -
  SPYM18_RS09515 (spyM18_2225) sdaAA 1865911..1866783 (+) 873 WP_002982073.1 L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha -
  SPYM18_RS09520 (spyM18_2226) - 1867197..1867811 (-) 615 WP_002991425.1 transglycosylase SLT domain-containing protein -
  SPYM18_RS09525 (spyM18_2228) - 1868182..1868982 (-) 801 WP_002991426.1 energy-coupling factor transporter transmembrane component T family protein -
  SPYM18_RS09530 (spyM18_2229) - 1868975..1869817 (-) 843 WP_002982066.1 energy-coupling factor transporter ATPase -
  SPYM18_RS09535 (spyM18_2230) - 1869793..1870632 (-) 840 WP_002992388.1 energy-coupling factor ABC transporter ATP-binding protein -
  SPYM18_RS09540 (spyM18_2231) pgsA 1870634..1871176 (-) 543 WP_011018338.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  SPYM18_RS09545 (spyM18_2232) - 1871190..1872215 (-) 1026 WP_002982055.1 helix-turn-helix domain-containing protein -
  SPYM18_RS09550 (spyM18_2233) yfmH 1872265..1873554 (-) 1290 WP_002982050.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  SPYM18_RS09555 (spyM18_2234) yfmF 1873556..1874800 (-) 1245 WP_011018339.1 EF-P 5-aminopentanol modification-associated protein YfmF -

Sequence

Protein


Download         Length: 237 a.a.        Molecular weight: 27620.79 Da        Isoelectric Point: 9.6307

>NTDB_id=21957 SPYM18_RS09235 WP_002992823.1 1811039..1811752(+) (treR) [Streptococcus pyogenes MGAS8232]
MTKYERIYKDLETKINKDFYKEGDFLPTEIELSQQYQASRDTVRKALSLLTKAGLILKKQGRGTQVIRHHQIMFPISELT
SYQELVSYSNLDSKTNVIAIDKLIVDETLSKLTGFSKNSLVWRVTRQRVVEGVASVLDIDYLSKTLVPIMTREIAEHSIY
QYLEKELHLAIDFALKEVTIDQITDRDKILLDLGSDQHVVSVKSKVYLSNNNQFQFTESRHKLEKFKFLDFARRRPK

Nucleotide


Download         Length: 714 bp        

>NTDB_id=21957 SPYM18_RS09235 WP_002992823.1 1811039..1811752(+) (treR) [Streptococcus pyogenes MGAS8232]
ATGACAAAGTATGAACGTATTTATAAAGACCTCGAAACAAAAATAAACAAAGACTTTTACAAAGAAGGGGATTTTTTACC
TACTGAAATAGAATTGAGTCAACAATACCAAGCTAGCCGAGATACCGTCCGCAAGGCTCTCTCACTTCTCACAAAGGCAG
GTCTTATCCTCAAAAAACAAGGACGTGGCACCCAAGTGATTAGACATCATCAGATCATGTTCCCTATCTCAGAACTAACT
AGTTATCAGGAACTCGTCTCTTACTCAAATCTAGATTCTAAGACCAACGTCATTGCCATTGATAAACTGATTGTGGATGA
GACACTTTCAAAATTGACCGGTTTTAGCAAAAACAGCTTGGTCTGGCGTGTTACACGCCAACGCGTTGTTGAGGGTGTGG
CTTCCGTCTTAGACATTGATTACCTTAGTAAAACTTTGGTGCCAATAATGACAAGGGAAATCGCAGAGCATTCTATTTAT
CAATATTTGGAAAAGGAACTCCATCTCGCCATTGACTTTGCCCTCAAAGAGGTTACCATTGACCAAATAACCGATCGTGA
TAAAATTTTACTTGACCTTGGATCAGACCAACATGTTGTTTCCGTCAAATCCAAAGTCTACCTTTCCAATAATAACCAAT
TCCAATTCACCGAGAGTCGCCATAAACTGGAAAAATTTAAATTTTTAGATTTTGCTCGGCGCAGACCAAAATAA

Domains

Predicted by InterproScan.

Bacterial regulatory proteins, gntR family (GntR)

(3-66)

UTRA domain (UTRA)

(91-227)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  treR Streptococcus mutans UA159

68.376

98.734

0.675

Multiple sequence alignment