Detailed information
Overview
| Name | treR | Type | Regulator |
| Locus tag | SPYM18_RS09235 | Genome accession | NC_003485 |
| Coordinates | 1811039..1811752 (+) | Length | 237 a.a. |
| NCBI ID | WP_002992823.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS8232 | ||
| Function | regulate expression of competence genes (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1806706..1875030 | 1811039..1811752 | within | 0 |
Gene organization within MGE regions
Location: 1806706..1875030
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM18_RS09225 (spyM18_2154) | treC | 1807108..1808736 (-) | 1629 | WP_011018305.1 | alpha,alpha-phosphotrehalase | - |
| SPYM18_RS09230 (spyM18_2155) | treP | 1808804..1810828 (-) | 2025 | WP_011018306.1 | PTS system trehalose-specific EIIBC component | - |
| SPYM18_RS09235 (spyM18_2157) | treR | 1811039..1811752 (+) | 714 | WP_002992823.1 | trehalose operon repressor | Regulator |
| SPYM18_RS09240 (spyM18_2160) | - | 1812031..1812369 (-) | 339 | WP_011018307.1 | winged helix-turn-helix transcriptional regulator | - |
| SPYM18_RS09245 | - | 1812555..1813412 (+) | 858 | Protein_1801 | VOC family protein | - |
| SPYM18_RS09250 (spyM18_2163) | yaaA | 1813454..1814185 (+) | 732 | WP_011018309.1 | peroxide stress protein YaaA | - |
| SPYM18_RS09255 (spyM18_2164) | nrdG | 1814359..1814973 (-) | 615 | WP_011018310.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
| SPYM18_RS09260 (spyM18_2165) | - | 1814973..1815482 (-) | 510 | WP_011018311.1 | GNAT family N-acetyltransferase | - |
| SPYM18_RS09265 (spyM18_2166) | - | 1815491..1816426 (-) | 936 | WP_011018312.1 | Gfo/Idh/MocA family protein | - |
| SPYM18_RS10415 (spyM18_2167) | - | 1816455..1816601 (-) | 147 | WP_002982210.1 | hypothetical protein | - |
| SPYM18_RS09270 (spyM18_2168) | nrdD | 1816783..1818981 (-) | 2199 | WP_002992831.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| SPYM18_RS09275 (spyM18_2169) | - | 1819078..1820637 (-) | 1560 | WP_002992833.1 | membrane protein | - |
| SPYM18_RS09280 (spyM18_2170) | - | 1821050..1821355 (-) | 306 | WP_002982199.1 | DUF1292 domain-containing protein | - |
| SPYM18_RS09285 (spyM18_2171) | ruvX | 1821367..1821786 (-) | 420 | WP_002982196.1 | Holliday junction resolvase RuvX | - |
| SPYM18_RS09290 (spyM18_2172) | - | 1821783..1822052 (-) | 270 | WP_002982194.1 | IreB family regulatory phosphoprotein | - |
| SPYM18_RS09295 (spyM18_2173) | spx | 1822165..1822563 (-) | 399 | WP_002982188.1 | transcriptional regulator Spx | - |
| SPYM18_RS09300 (spyM18_2174) | recA | 1822854..1823990 (-) | 1137 | WP_002982186.1 | recombinase RecA | Machinery gene |
| SPYM18_RS09305 (spyM18_2175) | cinA | 1824079..1825350 (-) | 1272 | WP_011018313.1 | competence/damage-inducible protein A | Machinery gene |
| SPYM18_RS09310 (spyM18_2176) | - | 1825419..1825979 (-) | 561 | WP_011018314.1 | DNA-3-methyladenine glycosylase I | - |
| SPYM18_RS09315 (spyM18_2177) | ruvA | 1825989..1826585 (-) | 597 | WP_011018315.1 | Holliday junction branch migration protein RuvA | - |
| SPYM18_RS09320 (spyM18_2178) | - | 1826587..1827807 (-) | 1221 | WP_011018316.1 | MDR family MFS transporter | - |
| SPYM18_RS09325 (spyM18_2179) | mutL | 1827818..1829800 (-) | 1983 | WP_011018317.1 | DNA mismatch repair endonuclease MutL | - |
| SPYM18_RS09330 (spyM18_2180) | mutS | 1829929..1832484 (-) | 2556 | WP_011018318.1 | DNA mismatch repair protein MutS | - |
| SPYM18_RS10720 | - | 1832471..1832823 (-) | 353 | Protein_1820 | YlbF family regulator | - |
| SPYM18_RS09340 (spyM18_2182) | argR | 1832820..1833257 (-) | 438 | WP_002982171.1 | arginine repressor | - |
| SPYM18_RS09345 (spyM18_2183) | argS | 1833548..1835239 (+) | 1692 | WP_011018320.1 | arginine--tRNA ligase | - |
| SPYM18_RS09350 (spyM18_2184) | - | 1835327..1835635 (+) | 309 | WP_002991370.1 | bacteriocin immunity protein | - |
| SPYM18_RS09355 (spyM18_2185) | - | 1835662..1836534 (-) | 873 | WP_002982164.1 | YitT family protein | - |
| SPYM18_RS09360 (spyM18_2186) | - | 1836577..1837455 (-) | 879 | WP_011018321.1 | YitT family protein | - |
| SPYM18_RS09365 (spyM18_2187) | - | 1837475..1838416 (-) | 942 | WP_010922775.1 | YitT family protein | - |
| SPYM18_RS09370 (spyM18_2188) | aspS | 1838409..1840157 (-) | 1749 | WP_009880608.1 | aspartate--tRNA ligase | - |
| SPYM18_RS09375 (spyM18_2189) | hisS | 1840495..1841775 (-) | 1281 | WP_011018322.1 | histidine--tRNA ligase | - |
| SPYM18_RS09380 (spyM18_2190) | - | 1841984..1842976 (+) | 993 | WP_011018323.1 | IS30-like element IS1239 family transposase | - |
| SPYM18_RS09385 (spyM18_2196) | rpmF | 1843081..1843263 (+) | 183 | WP_000290414.1 | 50S ribosomal protein L32 | - |
| SPYM18_RS09390 (spyM18_2197) | rpmG | 1843279..1843428 (+) | 150 | WP_002982147.1 | 50S ribosomal protein L33 | - |
| SPYM18_RS10585 | - | 1843511..1843693 (-) | 183 | Protein_1832 | hypothetical protein | - |
| SPYM18_RS09400 (spyM18_2198) | - | 1843722..1844336 (+) | 615 | WP_000615739.1 | CadD family cadmium resistance transporter | - |
| SPYM18_RS09405 (spyM18_2199) | cadX | 1844348..1844686 (+) | 339 | WP_000711093.1 | Cd(II)/Zn(II)-sensing metalloregulatory transcriptional regulator CadX | - |
| SPYM18_RS09415 | - | 1844730..1845632 (+) | 903 | Protein_1835 | XRE family transcriptional regulator | - |
| SPYM18_RS09420 (spyM18_2201) | - | 1845626..1846460 (+) | 835 | Protein_1836 | ABC transporter ATP-binding protein | - |
| SPYM18_RS09425 (spyM18_2203) | - | 1846457..1847059 (+) | 603 | WP_011018327.1 | hypothetical protein | - |
| SPYM18_RS10220 | - | 1847534..1847755 (-) | 222 | WP_226976787.1 | transcriptional regulator | - |
| SPYM18_RS10790 | - | 1847822..1847866 (-) | 45 | Protein_1839 | hypothetical protein | - |
| SPYM18_RS09435 (spyM18_2207) | - | 1848269..1849111 (+) | 843 | WP_003062683.1 | DUF368 domain-containing protein | - |
| SPYM18_RS09440 | - | 1849158..1849799 (-) | 642 | WP_023079624.1 | NUDIX hydrolase | - |
| SPYM18_RS09445 (spyM18_2210) | - | 1850006..1850332 (+) | 327 | WP_002982104.1 | PadR family transcriptional regulator | - |
| SPYM18_RS09450 (spyM18_2211) | - | 1850319..1850906 (+) | 588 | WP_011018329.1 | DUF1700 domain-containing protein | - |
| SPYM18_RS09455 (spyM18_2212) | - | 1850903..1851985 (+) | 1083 | WP_011018330.1 | DUF4097 family beta strand repeat-containing protein | - |
| SPYM18_RS09460 (spyM18_2213) | - | 1852054..1854327 (-) | 2274 | WP_011018331.1 | YhgE/Pip domain-containing protein | - |
| SPYM18_RS09465 (spyM18_2214) | - | 1854462..1854995 (+) | 534 | WP_002991404.1 | TetR/AcrR family transcriptional regulator | - |
| SPYM18_RS09470 (spyM18_2215) | rpsD | 1855151..1855762 (-) | 612 | WP_002982092.1 | 30S ribosomal protein S4 | - |
| SPYM18_RS09475 (spyM18_2216) | - | 1856491..1856763 (-) | 273 | WP_002991405.1 | Veg family protein | - |
| SPYM18_RS09480 (spyM18_2217) | dnaB | 1856780..1858147 (-) | 1368 | WP_011889251.1 | replicative DNA helicase | - |
| SPYM18_RS09485 (spyM18_2218) | rplI | 1858177..1858629 (-) | 453 | WP_002982086.1 | 50S ribosomal protein L9 | - |
| SPYM18_RS09490 (spyM18_2219) | - | 1858626..1860602 (-) | 1977 | WP_011018333.1 | DHH family phosphoesterase | - |
| SPYM18_RS09495 (spyM18_2220) | mnmG | 1860692..1862590 (-) | 1899 | WP_011018334.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| SPYM18_RS09500 (spyM18_2221) | - | 1862735..1863031 (-) | 297 | WP_011018335.1 | NUDIX domain-containing protein | - |
| SPYM18_RS09505 (spyM18_2222) | mnmA | 1863809..1864930 (-) | 1122 | WP_023079620.1 | tRNA 2-thiouridine(34) synthase MnmA | - |
| SPYM18_RS09510 (spyM18_2224) | sdaAB | 1865228..1865899 (+) | 672 | WP_002982075.1 | L-serine ammonia-lyase, iron-sulfur-dependent subunit beta | - |
| SPYM18_RS09515 (spyM18_2225) | sdaAA | 1865911..1866783 (+) | 873 | WP_002982073.1 | L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha | - |
| SPYM18_RS09520 (spyM18_2226) | - | 1867197..1867811 (-) | 615 | WP_002991425.1 | transglycosylase SLT domain-containing protein | - |
| SPYM18_RS09525 (spyM18_2228) | - | 1868182..1868982 (-) | 801 | WP_002991426.1 | energy-coupling factor transporter transmembrane component T family protein | - |
| SPYM18_RS09530 (spyM18_2229) | - | 1868975..1869817 (-) | 843 | WP_002982066.1 | energy-coupling factor transporter ATPase | - |
| SPYM18_RS09535 (spyM18_2230) | - | 1869793..1870632 (-) | 840 | WP_002992388.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
| SPYM18_RS09540 (spyM18_2231) | pgsA | 1870634..1871176 (-) | 543 | WP_011018338.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| SPYM18_RS09545 (spyM18_2232) | - | 1871190..1872215 (-) | 1026 | WP_002982055.1 | helix-turn-helix domain-containing protein | - |
| SPYM18_RS09550 (spyM18_2233) | yfmH | 1872265..1873554 (-) | 1290 | WP_002982050.1 | EF-P 5-aminopentanol modification-associated protein YfmH | - |
| SPYM18_RS09555 (spyM18_2234) | yfmF | 1873556..1874800 (-) | 1245 | WP_011018339.1 | EF-P 5-aminopentanol modification-associated protein YfmF | - |
Sequence
Protein
Download Length: 237 a.a. Molecular weight: 27620.79 Da Isoelectric Point: 9.6307
>NTDB_id=21957 SPYM18_RS09235 WP_002992823.1 1811039..1811752(+) (treR) [Streptococcus pyogenes MGAS8232]
MTKYERIYKDLETKINKDFYKEGDFLPTEIELSQQYQASRDTVRKALSLLTKAGLILKKQGRGTQVIRHHQIMFPISELT
SYQELVSYSNLDSKTNVIAIDKLIVDETLSKLTGFSKNSLVWRVTRQRVVEGVASVLDIDYLSKTLVPIMTREIAEHSIY
QYLEKELHLAIDFALKEVTIDQITDRDKILLDLGSDQHVVSVKSKVYLSNNNQFQFTESRHKLEKFKFLDFARRRPK
MTKYERIYKDLETKINKDFYKEGDFLPTEIELSQQYQASRDTVRKALSLLTKAGLILKKQGRGTQVIRHHQIMFPISELT
SYQELVSYSNLDSKTNVIAIDKLIVDETLSKLTGFSKNSLVWRVTRQRVVEGVASVLDIDYLSKTLVPIMTREIAEHSIY
QYLEKELHLAIDFALKEVTIDQITDRDKILLDLGSDQHVVSVKSKVYLSNNNQFQFTESRHKLEKFKFLDFARRRPK
Nucleotide
Download Length: 714 bp
>NTDB_id=21957 SPYM18_RS09235 WP_002992823.1 1811039..1811752(+) (treR) [Streptococcus pyogenes MGAS8232]
ATGACAAAGTATGAACGTATTTATAAAGACCTCGAAACAAAAATAAACAAAGACTTTTACAAAGAAGGGGATTTTTTACC
TACTGAAATAGAATTGAGTCAACAATACCAAGCTAGCCGAGATACCGTCCGCAAGGCTCTCTCACTTCTCACAAAGGCAG
GTCTTATCCTCAAAAAACAAGGACGTGGCACCCAAGTGATTAGACATCATCAGATCATGTTCCCTATCTCAGAACTAACT
AGTTATCAGGAACTCGTCTCTTACTCAAATCTAGATTCTAAGACCAACGTCATTGCCATTGATAAACTGATTGTGGATGA
GACACTTTCAAAATTGACCGGTTTTAGCAAAAACAGCTTGGTCTGGCGTGTTACACGCCAACGCGTTGTTGAGGGTGTGG
CTTCCGTCTTAGACATTGATTACCTTAGTAAAACTTTGGTGCCAATAATGACAAGGGAAATCGCAGAGCATTCTATTTAT
CAATATTTGGAAAAGGAACTCCATCTCGCCATTGACTTTGCCCTCAAAGAGGTTACCATTGACCAAATAACCGATCGTGA
TAAAATTTTACTTGACCTTGGATCAGACCAACATGTTGTTTCCGTCAAATCCAAAGTCTACCTTTCCAATAATAACCAAT
TCCAATTCACCGAGAGTCGCCATAAACTGGAAAAATTTAAATTTTTAGATTTTGCTCGGCGCAGACCAAAATAA
ATGACAAAGTATGAACGTATTTATAAAGACCTCGAAACAAAAATAAACAAAGACTTTTACAAAGAAGGGGATTTTTTACC
TACTGAAATAGAATTGAGTCAACAATACCAAGCTAGCCGAGATACCGTCCGCAAGGCTCTCTCACTTCTCACAAAGGCAG
GTCTTATCCTCAAAAAACAAGGACGTGGCACCCAAGTGATTAGACATCATCAGATCATGTTCCCTATCTCAGAACTAACT
AGTTATCAGGAACTCGTCTCTTACTCAAATCTAGATTCTAAGACCAACGTCATTGCCATTGATAAACTGATTGTGGATGA
GACACTTTCAAAATTGACCGGTTTTAGCAAAAACAGCTTGGTCTGGCGTGTTACACGCCAACGCGTTGTTGAGGGTGTGG
CTTCCGTCTTAGACATTGATTACCTTAGTAAAACTTTGGTGCCAATAATGACAAGGGAAATCGCAGAGCATTCTATTTAT
CAATATTTGGAAAAGGAACTCCATCTCGCCATTGACTTTGCCCTCAAAGAGGTTACCATTGACCAAATAACCGATCGTGA
TAAAATTTTACTTGACCTTGGATCAGACCAACATGTTGTTTCCGTCAAATCCAAAGTCTACCTTTCCAATAATAACCAAT
TCCAATTCACCGAGAGTCGCCATAAACTGGAAAAATTTAAATTTTTAGATTTTGCTCGGCGCAGACCAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| treR | Streptococcus mutans UA159 |
68.376 |
98.734 |
0.675 |