Detailed information
Bioinformatically predicted
Overview
| Name | recA | Type | Machinery gene |
| Locus tag | B1222_RS27615 | Genome accession | NZ_CP019794 |
| Coordinates | 594166..594429 (-) | Length | 87 a.a. |
| NCBI ID | WP_390905536.1 | Uniprot ID | - |
| Organism | Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537 | ||
| Function | homologous recombination (predicted from homology) Homologous recombination |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 567107..609022 | 594166..594429 | within | 0 |
Gene organization within MGE regions
Location: 567107..609022
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| B1222_RS02750 (B1222_02735) | - | 568014..568202 (-) | 189 | WP_024094220.1 | MarR family transcriptional regulator | - |
| B1222_RS02760 (B1222_02745) | - | 568531..568863 (+) | 333 | WP_077995479.1 | DUF4064 domain-containing protein | - |
| B1222_RS02765 (B1222_02750) | - | 569255..570496 (-) | 1242 | WP_158672784.1 | ADP-ribosyltransferase | - |
| B1222_RS02770 (B1222_02755) | - | 570827..571756 (-) | 930 | WP_077995481.1 | RICIN domain-containing protein | - |
| B1222_RS02775 (B1222_02760) | - | 571927..573150 (+) | 1224 | WP_077995397.1 | IS256 family transposase | - |
| B1222_RS02780 (B1222_02765) | - | 573171..575294 (-) | 2124 | WP_077995482.1 | binary toxin-like calcium binding domain-containing protein | - |
| B1222_RS02785 (B1222_02770) | - | 575365..576174 (-) | 810 | WP_077995483.1 | hypothetical protein | - |
| B1222_RS02790 (B1222_02775) | - | 576376..577600 (-) | 1225 | Protein_574 | IS256 family transposase | - |
| B1222_RS25495 | - | 578494..578595 (-) | 102 | WP_237088715.1 | YjcZ family sporulation protein | - |
| B1222_RS02800 (B1222_02785) | - | 578966..579208 (+) | 243 | WP_374050032.1 | YqaE/Pmp3 family membrane protein | - |
| B1222_RS02805 (B1222_02790) | - | 579410..579841 (+) | 432 | WP_051427803.1 | universal stress protein | - |
| B1222_RS02810 (B1222_02795) | - | 579844..581363 (-) | 1520 | Protein_578 | IS1182 family transposase | - |
| B1222_RS24470 | - | 581744..581890 (+) | 147 | WP_188318608.1 | hypothetical protein | - |
| B1222_RS02815 (B1222_02800) | - | 582015..582956 (-) | 942 | WP_188318609.1 | LCP family protein | - |
| B1222_RS02820 (B1222_02805) | - | 583444..583866 (-) | 423 | WP_172423310.1 | RicAFT regulatory complex protein RicA family protein | - |
| B1222_RS02825 (B1222_02810) | miaB | 583898..585378 (-) | 1481 | Protein_582 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | - |
| B1222_RS02830 (B1222_02815) | pduL | 585510..586079 (-) | 570 | WP_036654067.1 | phosphate propanoyltransferase | - |
| B1222_RS02835 (B1222_02820) | - | 586203..587068 (-) | 866 | Protein_584 | 2-oxoacid:ferredoxin oxidoreductase subunit beta | - |
| B1222_RS02840 (B1222_02825) | - | 587056..588804 (-) | 1749 | Protein_585 | 2-oxoacid:acceptor oxidoreductase subunit alpha | - |
| B1222_RS02845 (B1222_02830) | - | 589009..589943 (-) | 935 | Protein_586 | dipeptidase | - |
| B1222_RS02850 (B1222_02835) | - | 590100..590360 (-) | 261 | WP_005550495.1 | stage V sporulation protein S | - |
| B1222_RS02855 (B1222_02840) | - | 590472..591266 (-) | 795 | WP_042119010.1 | TIGR00282 family metallophosphoesterase | - |
| B1222_RS02860 (B1222_02845) | rny | 591374..592915 (-) | 1542 | WP_036654059.1 | ribonuclease Y | - |
| B1222_RS02865 (B1222_02850) | - | 593411..594067 (-) | 657 | WP_077995485.1 | RecX family transcriptional regulator | - |
| B1222_RS27615 | recA | 594166..594429 (-) | 264 | WP_390905536.1 | hypothetical protein | Machinery gene |
| B1222_RS27620 | recA | 594469..595135 (-) | 667 | Protein_592 | recombinase RecA | - |
| B1222_RS27005 | - | 595397..596179 (-) | 783 | WP_315861962.1 | nicotinamide-nucleotide amidohydrolase family protein | - |
| B1222_RS27010 | cinA | 596185..596652 (-) | 468 | WP_315861963.1 | molybdopterin-binding protein | Machinery gene |
| B1222_RS02880 (B1222_02865) | pgsA | 596781..597359 (-) | 579 | WP_024094239.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| B1222_RS02885 (B1222_02870) | rimO | 597356..598681 (-) | 1326 | Protein_596 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| B1222_RS02890 (B1222_02875) | - | 598824..599315 (-) | 492 | WP_077995486.1 | YajQ family cyclic di-GMP-binding protein | - |
| B1222_RS02895 (B1222_02880) | - | 599343..600350 (-) | 1008 | WP_024094241.1 | RodZ family helix-turn-helix domain-containing protein | - |
| B1222_RS02900 (B1222_02885) | - | 600403..601166 (-) | 764 | Protein_599 | DUF3388 domain-containing protein | - |
| B1222_RS02905 (B1222_02890) | - | 601269..602132 (-) | 864 | WP_077995487.1 | hypothetical protein | - |
| B1222_RS02910 (B1222_02895) | - | 602236..602487 (-) | 252 | WP_023484662.1 | DUF3243 domain-containing protein | - |
| B1222_RS02915 (B1222_02900) | ymfI | 602620..603370 (-) | 751 | Protein_602 | elongation factor P 5-aminopentanone reductase | - |
| B1222_RS02920 (B1222_02905) | yfmH | 603370..604656 (-) | 1287 | WP_077995488.1 | EF-P 5-aminopentanol modification-associated protein YfmH | - |
| B1222_RS02925 (B1222_02910) | yfmF | 604653..605938 (-) | 1286 | Protein_604 | EF-P 5-aminopentanol modification-associated protein YfmF | - |
| B1222_RS02930 (B1222_02915) | sleB | 606105..606905 (-) | 801 | WP_023484666.1 | spore cortex-lytic enzyme | - |
Sequence
Protein
Download Length: 87 a.a. Molecular weight: 9828.73 Da Isoelectric Point: 3.9866
>NTDB_id=218402 B1222_RS27615 WP_390905536.1 594166..594429(-) (recA) [Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537]
MYGEGISKEGSLVDIASEMDIINKSGAWYSYNNDRLGQGRENAKQFLKENPQISQEIEQKIREASNLTTTVPAVTEEENE
DLELSFE
MYGEGISKEGSLVDIASEMDIINKSGAWYSYNNDRLGQGRENAKQFLKENPQISQEIEQKIREASNLTTTVPAVTEEENE
DLELSFE
Nucleotide
Download Length: 264 bp
>NTDB_id=218402 B1222_RS27615 WP_390905536.1 594166..594429(-) (recA) [Paenibacillus larvae subsp. pulvifaciens strain ATCC 13537]
ATGTATGGTGAAGGTATCTCCAAGGAAGGAAGTCTTGTAGACATTGCTTCCGAGATGGATATCATTAATAAAAGTGGAGC
CTGGTATTCATACAATAATGACCGGCTTGGCCAGGGCAGAGAGAACGCAAAGCAATTTCTGAAAGAAAATCCGCAAATCT
CTCAAGAGATCGAACAAAAAATCCGCGAGGCAAGCAATCTAACAACGACCGTTCCCGCCGTGACAGAAGAAGAGAATGAA
GATTTGGAGCTTAGTTTTGAATAA
ATGTATGGTGAAGGTATCTCCAAGGAAGGAAGTCTTGTAGACATTGCTTCCGAGATGGATATCATTAATAAAAGTGGAGC
CTGGTATTCATACAATAATGACCGGCTTGGCCAGGGCAGAGAGAACGCAAAGCAATTTCTGAAAGAAAATCCGCAAATCT
CTCAAGAGATCGAACAAAAAATCCGCGAGGCAAGCAATCTAACAACGACCGTTCCCGCCGTGACAGAAGAAGAGAATGAA
GATTTGGAGCTTAGTTTTGAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.