Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | CXP32_RS02730 | Genome accession | NZ_CP025256 |
| Coordinates | 515807..515956 (+) | Length | 49 a.a. |
| NCBI ID | WP_001818346.1 | Uniprot ID | Q9FBH1 |
| Organism | Streptococcus pneumoniae strain Xen35 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 510807..520956
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CXP32_RS12670 (CXP32_02670) | comA/nlmT | 510848..511435 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| CXP32_RS02675 (CXP32_02675) | blpI | 511717..511914 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| CXP32_RS02685 (CXP32_02685) | blpJ | 512381..512650 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| CXP32_RS02690 (CXP32_02690) | blpU | 512719..512949 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| CXP32_RS02695 (CXP32_02695) | - | 512952..513071 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| CXP32_RS11970 (CXP32_02700) | - | 513368..513532 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| CXP32_RS02705 (CXP32_02705) | - | 513529..513933 (+) | 405 | WP_000846943.1 | hypothetical protein | - |
| CXP32_RS02710 (CXP32_02710) | - | 514136..514940 (+) | 805 | WP_100214365.1 | IS5 family transposase | - |
| CXP32_RS02715 (CXP32_02715) | blpM | 515090..515344 (+) | 255 | WP_000379879.1 | two-peptide bacteriocin subunit BlpM | - |
| CXP32_RS02720 (CXP32_02720) | blpN | 515360..515563 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| CXP32_RS02730 (CXP32_02730) | cipB | 515807..515956 (+) | 150 | WP_001818346.1 | bacteriocin-like peptide BlpO | Regulator |
| CXP32_RS02735 (CXP32_02735) | - | 516060..516179 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| CXP32_RS02745 (CXP32_02745) | - | 516965..517348 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| CXP32_RS02750 (CXP32_02750) | - | 517400..518089 (+) | 690 | WP_000760538.1 | CPBP family intramembrane glutamic endopeptidase | - |
| CXP32_RS02755 (CXP32_02755) | blpZ | 518131..518364 (+) | 234 | WP_000276498.1 | immunity protein BlpZ | - |
| CXP32_RS02765 (CXP32_02765) | - | 518515..519126 (+) | 612 | WP_000394045.1 | type II CAAX endopeptidase family protein | - |
| CXP32_RS02770 (CXP32_02770) | - | 519287..520081 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
| CXP32_RS02775 (CXP32_02775) | trmB | 520078..520713 (+) | 636 | WP_001266083.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5134.91 Da Isoelectric Point: 3.9133
>NTDB_id=217882 CXP32_RS02730 WP_001818346.1 515807..515956(+) (cipB) [Streptococcus pneumoniae strain Xen35]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=217882 CXP32_RS02730 WP_001818346.1 515807..515956(+) (cipB) [Streptococcus pneumoniae strain Xen35]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |