Detailed information    

insolico Bioinformatically predicted

Overview

Name   HI0659   Type   Machinery gene
Locus tag   BWR56_RS02150 Genome accession   NZ_CP019562
Coordinates   453113..453406 (+) Length   97 a.a.
NCBI ID   WP_076984366.1    Uniprot ID   -
Organism   Streptococcus oralis strain S.MIT/ORALIS-351     
Function   DNA uptake (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 447658..461783 453113..453406 within 0


Gene organization within MGE regions


Location: 447658..461783
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BWR56_RS02115 (BWR56_0415) - 447658..448731 (+) 1074 WP_076984359.1 hypothetical protein -
  BWR56_RS02120 (BWR56_0416) - 448737..450125 (+) 1389 WP_076984360.1 hypothetical protein -
  BWR56_RS02125 (BWR56_0417) - 450302..450640 (+) 339 WP_076984361.1 type II toxin-antitoxin system RelE/ParE family toxin -
  BWR56_RS02130 (BWR56_0418) - 450633..451718 (+) 1086 WP_076984362.1 HigA family addiction module antitoxin -
  BWR56_RS02135 (BWR56_0419) - 451848..452252 (+) 405 WP_076984363.1 YbgA family protein -
  BWR56_RS02140 (BWR56_0420) - 452236..452601 (+) 366 WP_076984364.1 TIGR02328 family protein -
  BWR56_RS02145 (BWR56_0421) - 452758..453123 (+) 366 WP_076984365.1 type II toxin-antitoxin system RelE/ParE family toxin -
  BWR56_RS02150 (BWR56_0422) HI0659 453113..453406 (+) 294 WP_076984366.1 helix-turn-helix domain-containing protein Machinery gene
  BWR56_RS02155 (BWR56_0423) metE 453759..456008 (+) 2250 WP_076984367.1 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase -
  BWR56_RS02160 (BWR56_0424) metF 456069..456935 (+) 867 WP_049504734.1 methylenetetrahydrofolate reductase [NAD(P)H] -
  BWR56_RS02165 (BWR56_0425) pnp 457516..459729 (+) 2214 WP_076984368.1 polyribonucleotide nucleotidyltransferase -
  BWR56_RS02170 (BWR56_0426) cysE 459744..460361 (+) 618 WP_049552181.1 serine O-acetyltransferase -
  BWR56_RS02175 (BWR56_0427) - 460373..461239 (+) 867 WP_076984369.1 GNAT family N-acetyltransferase -
  BWR56_RS02180 (BWR56_0428) - 461262..461783 (+) 522 WP_076984370.1 dihydrofolate reductase family protein -

Sequence

Protein


Download         Length: 97 a.a.        Molecular weight: 10765.41 Da        Isoelectric Point: 5.1991

>NTDB_id=216310 BWR56_RS02150 WP_076984366.1 453113..453406(+) (HI0659) [Streptococcus oralis strain S.MIT/ORALIS-351]
MKNSAIGSNWKDVRSELFTKEEILESDMRVAIMSELIEARHEQGISQKKLEELSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEQEKN

Nucleotide


Download         Length: 294 bp        

>NTDB_id=216310 BWR56_RS02150 WP_076984366.1 453113..453406(+) (HI0659) [Streptococcus oralis strain S.MIT/ORALIS-351]
ATGAAGAATAGTGCTATTGGGAGTAATTGGAAAGATGTCCGCTCTGAACTCTTCACCAAGGAGGAAATCCTTGAAAGTGA
TATGCGAGTGGCTATCATGAGTGAGTTGATTGAAGCCAGACACGAGCAAGGTATCAGTCAGAAAAAGCTAGAGGAACTCA
GTGGAGTGAGCCAGCCTGTCATAGCTAGGATGGAGACAGGAAAGACTAGTCCTCAGTTGGATACGGTCTTAAAAGTCTTA
GCCAGTTTAGGAAAGACACTAGCAGTCGTCCCACTTGAACAGGAAAAAAATTGA

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(37-88)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  HI0659 Haemophilus influenzae Rd KW20

59.341

93.814

0.557

Multiple sequence alignment