Detailed information    

insolico Bioinformatically predicted

Overview

Name   treR   Type   Regulator
Locus tag   BZG42_RS01225 Genome accession   NZ_CP019557
Coordinates   223908..224621 (+) Length   237 a.a.
NCBI ID   WP_024531595.1    Uniprot ID   -
Organism   Streptococcus sp. DAT741     
Function   regulate expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 212113..265685 223908..224621 within 0


Gene organization within MGE regions


Location: 212113..265685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BZG42_RS01190 (BZG42_01160) - 213064..213816 (-) 753 WP_120171259.1 CPBP family intramembrane glutamic endopeptidase -
  BZG42_RS01195 (BZG42_01165) - 213935..216430 (-) 2496 WP_155995526.1 ATP-dependent RecD-like DNA helicase -
  BZG42_RS01200 (BZG42_01170) lepB 216484..217110 (-) 627 WP_155995524.1 signal peptidase I -
  BZG42_RS01205 (BZG42_01175) rnhC 217125..218012 (-) 888 WP_120171261.1 ribonuclease HIII -
  BZG42_RS01210 (BZG42_01180) - 218320..219696 (+) 1377 WP_159780051.1 LysM domain-containing protein -
  BZG42_RS01215 (BZG42_01185) treC 219927..221558 (-) 1632 WP_155995350.1 alpha,alpha-phosphotrehalase -
  BZG42_RS01220 (BZG42_01190) treP 221681..223684 (-) 2004 WP_155995348.1 PTS system trehalose-specific EIIBC component -
  BZG42_RS01225 (BZG42_01195) treR 223908..224621 (+) 714 WP_024531595.1 trehalose operon repressor Regulator
  BZG42_RS01230 (BZG42_01200) - 224677..224988 (+) 312 WP_024531596.1 hypothetical protein -
  BZG42_RS01235 (BZG42_01205) - 224985..225533 (+) 549 WP_024531597.1 CvpA family protein -
  BZG42_RS01240 (BZG42_01210) - 225660..227993 (+) 2334 WP_155995346.1 endonuclease MutS2 -
  BZG42_RS01245 (BZG42_01215) - 228041..228685 (+) 645 WP_024531599.1 GNAT family N-acetyltransferase -
  BZG42_RS10005 (BZG42_01220) - 228755..230296 (-) 1542 WP_227985612.1 transglutaminase domain-containing protein -
  BZG42_RS01255 (BZG42_01225) trxA 230881..231195 (+) 315 WP_024532380.1 thioredoxin -
  BZG42_RS01260 (BZG42_01230) - 231410..232939 (+) 1530 WP_155995345.1 AMP-binding protein -
  BZG42_RS01265 (BZG42_01235) msrB 233331..234269 (+) 939 WP_155995344.1 peptide-methionine (R)-S-oxide reductase MsrB -
  BZG42_RS01270 (BZG42_01240) - 234710..236041 (+) 1332 WP_024532376.1 sodium:alanine symporter family protein -
  BZG42_RS01275 (BZG42_01245) - 236221..237057 (+) 837 WP_120171271.1 mechanosensitive ion channel family protein -
  BZG42_RS01280 (BZG42_01250) gdhA 237197..238543 (-) 1347 WP_024532167.1 NADP-specific glutamate dehydrogenase -
  BZG42_RS01285 (BZG42_01255) - 238868..239803 (+) 936 WP_155995343.1 dihydroorotate oxidase -
  BZG42_RS01290 (BZG42_01260) - 240143..240925 (-) 783 WP_155995342.1 ABC-2 family transporter protein -
  BZG42_RS01295 (BZG42_01265) - 240928..241707 (-) 780 WP_155995341.1 ABC-2 family transporter protein -
  BZG42_RS01300 (BZG42_01270) - 241700..242683 (-) 984 WP_155995340.1 ATP-binding cassette domain-containing protein -
  BZG42_RS01305 (BZG42_01275) - 242814..243320 (-) 507 WP_155962821.1 phosphatidylglycerophosphatase A -
  BZG42_RS01310 (BZG42_01280) - 243604..244674 (-) 1071 WP_155995339.1 DUF4097 family beta strand repeat-containing protein -
  BZG42_RS01315 (BZG42_01285) - 244671..245435 (-) 765 WP_155995338.1 hypothetical protein -
  BZG42_RS01320 (BZG42_01290) - 245422..245748 (-) 327 WP_024532159.1 PadR family transcriptional regulator -
  BZG42_RS01325 (BZG42_01295) - 245994..246794 (-) 801 WP_120171281.1 formate/nitrite transporter family protein -
  BZG42_RS01330 (BZG42_01300) - 247083..248603 (+) 1521 WP_024532157.1 helicase HerA-like domain-containing protein -
  BZG42_RS01335 (BZG42_01305) - 248795..249409 (+) 615 WP_155995408.1 CoA pyrophosphatase -
  BZG42_RS09925 - 249923..250243 (+) 321 WP_201443299.1 hypothetical protein -
  BZG42_RS09930 - 250343..250675 (+) 333 WP_201443300.1 hypothetical protein -
  BZG42_RS01345 (BZG42_01315) - 251249..252514 (-) 1266 WP_155995412.1 site-specific integrase -
  BZG42_RS01350 (BZG42_01320) - 252614..252865 (-) 252 WP_155995406.1 MerR family transcriptional regulator -
  BZG42_RS01355 (BZG42_01325) - 252867..253478 (-) 612 WP_155995404.1 replication protein -
  BZG42_RS01360 (BZG42_01330) - 253609..254220 (-) 612 WP_155995402.1 hypothetical protein -
  BZG42_RS01365 (BZG42_01335) - 254220..255305 (-) 1086 WP_155995400.1 ATP-binding cassette domain-containing protein -
  BZG42_RS01370 (BZG42_01340) - 255305..255625 (-) 321 WP_155995398.1 hypothetical protein -
  BZG42_RS01375 (BZG42_01345) - 255769..256254 (-) 486 WP_155995396.1 helix-turn-helix transcriptional regulator -
  BZG42_RS01380 (BZG42_01350) - 256780..258378 (+) 1599 WP_155995394.1 class I SAM-dependent DNA methyltransferase -
  BZG42_RS01385 (BZG42_01355) - 258365..259501 (+) 1137 WP_155995392.1 restriction endonuclease subunit S -
  BZG42_RS01390 (BZG42_01360) - 259494..262628 (+) 3135 WP_155995390.1 HsdR family type I site-specific deoxyribonuclease -
  BZG42_RS01395 (BZG42_01365) - 262818..264464 (+) 1647 WP_155995388.1 helix-turn-helix domain-containing protein -
  BZG42_RS01400 (BZG42_01370) - 264493..265290 (+) 798 WP_155995386.1 hypothetical protein -

Sequence

Protein


Download         Length: 237 a.a.        Molecular weight: 27391.37 Da        Isoelectric Point: 8.9094

>NTDB_id=216206 BZG42_RS01225 WP_024531595.1 223908..224621(+) (treR) [Streptococcus sp. DAT741]
MKKYQEIYNDLKEKIRTNVYLAETSLPTEQELQKIYGVSRDTVRKALAILTEGGLIQKVQGRGSMVLKQEILNFPISGLT
SYQELTDSLQLSTQTKVVHLDMITVDSSLSSLTGFETYSKVWKVIRTRSIDGKVSVVDTDYLSVDVVPKLTVDVAEKSIY
EYLENELGLDIAYAQKEITVEPTNREERRLLKAQDDYLVLIKSRVYLGDTRQFQYTESRHKIDKFRFVDFARRKRTL

Nucleotide


Download         Length: 714 bp        

>NTDB_id=216206 BZG42_RS01225 WP_024531595.1 223908..224621(+) (treR) [Streptococcus sp. DAT741]
ATGAAAAAGTATCAAGAAATTTATAATGACTTAAAAGAAAAAATACGGACAAATGTTTACCTAGCGGAAACTTCCTTGCC
TACAGAACAAGAACTTCAGAAAATTTACGGTGTCAGTCGCGATACTGTTCGTAAGGCCTTAGCCATTTTGACAGAGGGTG
GTCTGATTCAAAAGGTTCAGGGACGTGGCTCCATGGTTCTCAAGCAGGAAATTCTTAACTTTCCTATCTCAGGTCTGACT
TCCTATCAGGAATTAACAGATTCTCTTCAATTATCTACACAGACGAAGGTTGTTCACTTGGATATGATAACGGTTGATTC
TAGCCTTTCCAGCCTGACAGGTTTTGAGACTTACAGTAAGGTATGGAAAGTTATCCGTACACGTTCTATTGATGGAAAAG
TCTCTGTTGTGGATACAGATTATCTTTCTGTAGATGTGGTACCAAAGTTGACGGTGGATGTTGCTGAGAAGTCTATTTAC
GAATATCTGGAAAATGAGCTAGGCCTAGACATAGCATATGCACAAAAGGAAATCACCGTAGAGCCAACCAATCGAGAAGA
ACGCAGATTGTTGAAGGCGCAGGATGACTATTTGGTCTTAATCAAGTCGCGTGTCTATCTCGGTGATACCAGGCAGTTCC
AATACACAGAAAGTAGACACAAGATTGATAAATTCCGCTTTGTGGATTTTGCCCGCAGAAAGCGAACTTTATAG

Domains

Predicted by InterproScan.

UTRA domain (UTRA)

(91-226)

Bacterial regulatory proteins, gntR family (GntR)

(3-66)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  treR Streptococcus mutans UA159

52.119

99.578

0.519

Multiple sequence alignment