Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   CV724_RS07425 Genome accession   NZ_CP024952
Coordinates   1527984..1528097 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain B125A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1522984..1533097
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  CV724_RS07405 (CV724_07430) - 1523646..1525058 (-) 1413 WP_145727430.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  CV724_RS07410 (CV724_07435) comB10 1525129..1526259 (-) 1131 WP_145727431.1 DNA type IV secretion system protein ComB10 Machinery gene
  CV724_RS07415 (CV724_07440) comB9 1526252..1527250 (-) 999 WP_145727432.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  CV724_RS07420 (CV724_07445) comB8 1527250..1527987 (-) 738 WP_000660517.1 virB8 family protein Machinery gene
  CV724_RS07425 (CV724_07450) comB7 1527984..1528097 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  CV724_RS07430 (CV724_07455) comB6 1528113..1529168 (-) 1056 WP_145727433.1 P-type conjugative transfer protein TrbL Machinery gene
  CV724_RS07435 (CV724_07460) - 1529176..1530180 (-) 1005 WP_145727518.1 PDZ domain-containing protein -
  CV724_RS08350 - 1530180..1530473 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  CV724_RS08355 panD 1530483..1530833 (-) 351 WP_108310021.1 aspartate 1-decarboxylase -
  CV724_RS07445 (CV724_07470) - 1530823..1533048 (-) 2226 WP_145727434.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=215535 CV724_RS07425 WP_001217873.1 1527984..1528097(-) (comB7) [Helicobacter pylori strain B125A]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=215535 CV724_RS07425 WP_001217873.1 1527984..1528097(-) (comB7) [Helicobacter pylori strain B125A]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1